• Lagos State - Basic Schools List

  • Lagos State - Basic

  • Lagos - JAMB Trend Analysis - Degree Prog.

Lagos State - Basic Schools List

Lagos State
LGACODEINSTITUTIONTOWNSTATUSTYPECATEGORY
AGEGE24010001AANU OLUWAPO PRIMARY SCHOOL, OYEWOLEOYEWOLEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010002AFRICAN CHURCH CENTRAL PRIMARY SCHOOL, ONIWAYATOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010003AHMAD MEMORIAL MOSLEM PRIMARY SCHOOL, OKE- KATOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010004AJEGUNLE PRIMARY SCHOOL,OTUBU AGEGEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010005AKILO PRIMARY SCHOOL, OGBAMORONFOLU ST. AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010006AMOSUN NURSERY & PRIMARY SCHOOL, AMOSUNAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010009ARAROMI PRIMARY SCHOOL, AGEGEORILE AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010010BISHOP AJANA PRIMARY SCHOOL, OKE-KOTOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010011CHRIST APOSTOLIC CHURCH PRIMARY SCHOOL, AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010012COMMUNITYUNITY PRIMARY SCHOOL, IDI MANGOROTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010013DAIRY FARM NURSERY AND PRIMARY SCHOOL, SANGO AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010014DAROCHA PRIMARY SCHOOL, AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010015DISTRICT PRIMARY SCHOOL, AGEGETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010016DOPEMU PRIMARY SCHOOL, AGEGEDOPEMUPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010017IBIDO PRIMARY SCHOOL, OKE-KOTOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010018IBUKUNOLU PRIMARY SCHOOL, DOPEMUPAPA ASAFA DOPEMU AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010019IDEAL PRIMARY SCHOOL, TABON TABONAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010020IFELODUN PRIMARY SCHOOL, AGEGEOYEWOLEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010021IFEOLUWA PRIMARY SCHOOL, AGEGETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010022IREPODUN PRIMARY SCHOOL, AGEGETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010023ISSA WILLIAMS PRIMARY SCHOOL, AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010024JIBRIL MARTINS PRIMARY SCHOOL, AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010025KEKE PRIMARY SCHOOL, OBEMERO REMO KEKEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010026LADOJE PRIMARY SCHOO, Oko-ObaOKO-OBA AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010027LOCAL GOVERNMENT PRIMARY SCHOOL, AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010028METHODIST PRIMARY SCHOOL, TABON-TABONAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010029MOSES ORIMOLADE PRIMARY SCHOOL, OKE-KOTOOKE-OKOTO, ORILE, AGEGE.PUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010030ODUDUWA PRIMARY SCHOOL, ODUDUWATOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010031OKE-KOTO UNITED PRIMARY SCHOOL, OKE-KOTOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010032OKO-OBA PRIMARY SCHOOL, OKO-OBAOKO OBAPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010033OKUSANYA PRIMARY SCHOOL, TABON-TABONAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010034OLUSANYA PRIMARY SCHOOL, AGEGETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010035OORE-OFE PRIMARY SCHOOL, DOPEMATOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010036ORILE AGEGE PRIMARY SCHOOL, ORILE, AGEGELAGOSPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010037PROGRESSIVE PRIMARY SCHOOL, AGEGEOYEWELEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010038SACRED CHERUBIM & SERAPHIM SHILLO PRIMARY SCHOOL, OKE-KATOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010039SAKA TINUBU PRIMARY SCHOOL, ORILE AGEGE7 AIYEGBAMI STREET ORILE AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010040SALVATION PRIMARY SCHOOL, DOPEMUDOPEMU, AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010041SANNGO PRIMARY SCHOOL, SANNGO, AGEGEAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010042ST. PETERS BLESSED PRIMARY SCHOOL, OKE-KATOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010043ST. SAVIOURS PRIMARY SCHOOL, AGEGETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010044STATE PRIMARY SCHOOL, OYEWOLE, MULERO, AGEGEOYEWOLE, MULEROPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010045STATE PRIMARY SCHOOL, DOPEMUTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010046STATE PRIMARY SCHOOL, ILOROTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010047STATE PRIMARY SCHOOL, SANGOAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010048UNITY PRIMARY SCHOOL, MULEROOYEWOLEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010049YEWA PRIMARY SCHOOL, ORILEORILE AGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010050ZION A/C NURSERY AND PRIMARY SCHOOL, ALAGBAAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010061DE GREAT GRACEKEKEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010066ROSE VALLEY NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010069SEED OF FAITH PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010075ARDUS SALAM NURSERY AND PRIMARY SCHOOLAGEGEPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010079REX AND REGIONAL NURSERY AND PRIMARYTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010092BREV-FOB NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010096OPTIMUM INTERNATIONAL SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010101STARLITE NURSERY AND PRIMARY SCHOOLOKO OBA AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010113LAGOOZ MONTESSORIMULERO AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010118ESMOS GRACE MONTESSORI SCHOOLSTABON TABONPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010119ENOCK FAITH NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010120COSTAL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010124SAN NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010127DIVINE BLESSED CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010145UNION BAPTIST CHURCH NURSERY AND BASIC SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010154OLU VICTORYLAND NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010155GOGLEENS SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010157SEDA PHILIPS MONTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010161KENNYOLA NURSERY AND PRIMARY PRIVATE SCHOOLDOPEMUPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010163CUTELAND MONTESSORI SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010164LOLLYPOP NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010173TOFES EXCELLENT NURSERY AND PRIMARY SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010176BISTOVEM NURSERY PRY SCHOOLSAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010182BSJ NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010183TEMIDIRE NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010187DE-MATO PRIVATE NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010199JULI INTERNATIONAL NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010199JULI INTERNATIONAL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010200IJELU MODEL SCHOOLS NURSERY AND PRIMARYKEKEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010202TEZABETH MONTESSORI NURSERY AND PRIMARY SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010203CHLOEVILLE SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010204FUTURE CAREER NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010206HUJATUL ISLAM NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010210ATLAS NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010217SILVERPEN PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010218AYO-LOL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010222JELLY LAS NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010230EFUNTUNDE NURSERY AND PRIMARY SCHOOLKEKEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010231RUBINUS NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010243CHILDREN'S HOME NURSERY AND PRIMARY SCHOOLPAPA AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010247V.OG NURSERY AND PRIMARY SCHOOLORILE AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010248DOUBLE 'A' FOUNDATION SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010250DIVINE TOUCH NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010257ABARI NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010259JOAN'S NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010261OLUDAYE PRIVATE SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010263BRAVE HEART DAYCARE AND CHILDREN SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010273RUFFY NURSERY AND PRIMARY SCHOOLKEKEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010278SAINT HENOH NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010299KENNIOLA PRIVATE SCHOOLDOPEMU AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010305HARTLOVE SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010307BRIGHT HOPE CHILDREN SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010308OLUBUKOLA NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010312STELVIS PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010317RAHMAH PRIVATE SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010318OL BHARMS HEIGHT SCHOOLAKILOPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010320BARCLAYS MONTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010323IN HIS GRACE NURSERY AND PRIMARY SCHOOLPAPA ASHAFA, AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010326JEHOVAH TREE NURSERY AND PRIMARY SCHOOLADEDOSUPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010327TOPSTAR NURSERY AND PRIMARY SCHOOLAJAYI IBEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010333ILHAM NURSERY AND PRIMARY SCHOOLOGUNDELE STREETPRIVATEISLAMIYYAECCE AND PRIMARY
AGEGE24010339HERITAGE OF GOD NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010340GODS GLORY NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010342DIVINE FOUNDATION CHIOLDREN SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010345FUN BELL NURSERY AND PRIMARY SCHOOLPAPA AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010351HOPE DYNAMIC NURSERY AND PRIMARY SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010364JEPHTAH PRIVATE SCHOOLOGBA ASADEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010373EDVILLE NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010375VESSEL OF GRACE PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010377ADETOUN NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010398FITJOY PRIVATE SCHOOL PRE-PRIMARY AND PRIMARYAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010399GOLDEN STAR NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010403LEDMAS SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010406GRABEL INTERNATIONAL SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010411FOUNTAIN OF WISDOM NURSERY AND PRIMSRY SCHOOLOKO-OBAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010413ALLAHU LATIF NURSERY AND PRIMARY SCHOOLPAPA ASHAFA, AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010420PREACH THE WORD NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010424SARAH NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010430CHANCELLORS NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010436BENGEE KIDDIES FOUNDATION NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010447FITRAH CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010448OVERTURES PRECIOUS JEWELS SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010453WEAVERS PRIVATE SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010461CLEVERLAND INTERNATIONAL SCHOOL (PRY)TABOR TABORPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010463ASSUMPTA GLAD CHILDREN NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010466CHRISTA REIGN MONTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010473AL-FATAU NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010493AL-HIKMAT NURSEY AND PRIMARY SCHOOLAGEGEPRIVATEISLAMIYYAECCE AND PRIMARY
AGEGE24010501CHARLES PAM NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010511BRAIN STAR NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010513ETERLINK SCHOOL INTERNATIONALTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010516STATUS NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010519GRACEFORT NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010533SHIELDLAND NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010537ADEGOKE INTERNATIONAL NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010539JIMMY INTERNATIONAL NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010542RISING FIELD SCHOOL NUR&PRY 11 AFUWAPE STREET OKO-OBAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010555FADLULLAH NURSERY AND PRIMARY SCHOOLTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010560DADA ELSHADAI NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010563MANDULAND NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010565JOYLAND INTERNATIONAL NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010567AOS MONTESSORI NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010572ROLAK PRIVATE SCHOOLORILE AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010573VICTORYLAND PRIVATE SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010576GREAT GLORY NURSERY AND PRIMARYAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010581SIDDY SIDNEY NURSERY AND PRIMARYAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010596FUNMEX NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010597R&B NURSARY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010603DARUL ATFAL GROUP OF SCHOOLSPAPA AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010608CARONIKKY NURSERY AND PRIMARY SCHOOLORILE AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010609PRAISE NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010613GOSFAT NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010616MARIE CLAIRE NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010617OYINDAMOLA NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010619LEADERS GATE MONTESSORIAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010622ASPIRING GOAL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010627RIDWANLLAHI NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010628MORTON PRIVATE SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010631CHRIST FIELD NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010632ONIBUORE NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010639RAHMANIYYAH NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010642UPLIFTING TOWERTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010644PHINA'S NURSERY AND PRIMARY SCHOOLKEKEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010667MARVEDAN NUR & PRY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010668FRDAM FIELD NUSERY AND PRIMARY SCHOOLPAPA AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010671OPEN HEAVEN ACADEMYTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010681ABIKS PRIVATE NURSERY AND PRIMARY SCHOOLTABON TABON AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010688A & T NURSERY AND PRIMARY SCHOOLTABON TABONPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010704A'AWUNU GROUP OF SCHOOLSAGEGEPRIVATECONVENTIONALECCE ONLY
AGEGE24010706AL-HUDAH WARRAHMAHAGEGEPRIVATEISLAMIYYAECCE AND PRIMARY
AGEGE24010707PATRIOT NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010708GLORY OF GOD SCHOOL AGEGEONIWAYAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010709COMART SCIENCE SCHOOLONIWAYAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010710ELYON KIDDIES HALLDOPEMU AGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010711OLUWASUN NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010712FADL-I-OMAR ISLAMIC NURSERY & PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010713INDELIBLE PATTERN MONTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010714BUDTENDER NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010723ABYBUS SCHOOL AGEGEAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010724GODS PALACE NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010725GREAT SHARON NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010726SOUND PLANET NURSERY & PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010727VICTORY CHILDREN SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010729ETERNAL NURSERYAND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010731FAKOS NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010732BAMORS KINGS SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010733D &D NURSERY SCHOOLAGEGEPRIVATECONVENTIONALECCE ONLY
AGEGE24010735D & D PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALPRIMARY ONLY
AGEGE24010736DEBOMAT NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010737'ILM NAAFI'AAN NURSERY SCHOOLAGEGEPRIVATECONVENTIONALECCE ONLY
AGEGE24010743BRILLIANT ZINNIA NURSERY AND PRIMARY SCHOOLOWOLEWAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010744ELIZFIELD PRIVATE SCHOOLOLAREWAJU STR, OKO OBAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010747FLOURISH NURSERY AND PRIMARY SCHOOLALHAJI OLADIPOPO STREET,OKO OBAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010748LA-PAZ ACADEMYAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010749ELIDISH INTERNATIONAL SCHOOLITOGBEPRIVATECONVENTIONALECCE ONLY
AGEGE24010751FREEWILL ACADEMY INTERNATIONAL SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010752ROYALFIELD NURSERY AND PRIMARY SCHOOLOKO-OBAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010754WONDERFUL FOUNDATION SCHOOLOSHIDEHIN STREETPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010761VOCATIONAL CENTRE 2, STATE PRIMARY SCHOOL OYEWOLEVOYEWOLE- AGEGEPUBLICCONVENTIONALPRIMARY ONLY
AGEGE24010763BRITISH STANDARD MENTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010764TOBLAND NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010765GLOMOND NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010767GEE DEE MONTESSORI NURSERY AND PRIMARY SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010768BIVID NURSERY / PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010771HANNAH KIDDIESAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010772BAPTIST ACADEMY NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010774GLORY OF GOD NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010775CHESSINGTON MONTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010776BAPTIST ACADEMY NURSEY AND PRIMARY SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010776TRIUMPHANT SCHOLARS' SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010778PETRA NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010779MINNAH NURSERY AND PRIMARY SCHOOLPAPA ASHAFAPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010780UNITY ' T ' MONTESSORI SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010781ALICE BELL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010782BEST HOPE PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010786ST. MARK NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010787DAVID'S ROOT NURSERY AND PRIMARY SCHOOLTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AGEGE24010793BISDAF NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010794DE- ONLY ADVOCATE MONTESSORI NURSERY/ PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010795GREAT HERITAGE NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010796ADEVANS INTERNATIONAL NURSERY AND PRIMARY SCHOOL AGEGETOWNPRIVATECONVENTIONALECCE AND PRIMARY
AGEGE24010821ACIENTOF DAYS NURSERY AND PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020001AFRICAN PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020002AIYETORO PRIMARY SCHOOL, AJEGUNLETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020003AJEGUNLE PRIMARY SCHOOL, AWODI-ORAAWODI ORAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020004AJEGUNLE NURSERY/PRIMARY SCHOOL, OJOAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020005AJEROMI CENTRAL PRIMARY SCHOOL, AJEROMIAJEROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020006AJEROMI IFELODUN PRIMARY SCHOOL, AJEROMIOLODI-APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020007AJEROMI PUBLIC PRIMARY SCHOOL, AJEGUNLETOWNPUBLICCONVENTIONALPRIMARY ONLY
AJEROMI-IFELODUN24020008ALABA PRIMARY SCHOOL II, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020009ALABA PRIMARY SCHOOL 1, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020010ALAKOTO PRIMARY SCHOOL, ALAKOTOOLODI APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020011ANGLICAN PIMARY SCHOOL, ARAROMIARAROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020012ANGLICAN PRIMARY SCHOOL I, AJEGUNLETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020013ANGLICAN PRIMARY SCHOOL II, AIYETOROTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020014ARAROMI PRIMARY SCHOOL, OLODI-APAPA 2OLODI APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020015ASUBIOJO PRIMARY SCHOOL I, ORILE-IGANMUAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020016ASUBIOJO PRIMARY SCHOOL II, ALABA ORO, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020017AWODI-ORA PRIMARY SCHOOL, AWODI-ORAAWODI ORAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020018AYODELE PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020019CARDOSO PRIMARY SCHOOL, AJEGUNLEAJEROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020020CHRIST ASSEMBLY PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020021CHRIST THE KING PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020022EBENEZER PRIMARY SCHOOL, AWODI-ORAAWODI- ORAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020023FATHER SADIKU MEMORIAL PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020024GORIOLA PRIMARY SCHOOL I, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020025GORIOLA PRIMARY SCHOOL II, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020026IBAFON PRIMARY SCHOOL, OLODI APAPAOLODI APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020027IFELODUN PRIMARY SCHOOL, OWODI ORAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020028IRETI PRIMARY SCHOOL I, OJOALABAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020029IRETI PRIMARY SCHOOLII, OJOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020030JIMOH OJORA PRIMARY SCHOOL I, AMUKOKOAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020031JIMOH OJORA PRIMARY SCHOOL II, AMUKOKOAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020032KAJOLA PRIMARY SCHOOL, ARAROMIAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020033LAGOS STATE MODEL NURSERY AND PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020034LOCAL AUTHORITY PRIMARY SCHOOL I, AIYETOROTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020035LOCAL AUTHORITY PRIMARY SCHOOL I, AMUKOKOSAFEJO AMUKOKOPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020036LOCAL AUTHORITY PRIMARY SCHOOL II, AIYETOROTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020038LOCAL AUTHORITY PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020039LOCAL AUTHORITY PRIMARY SCHOOL, LAYENI, AJEGUNLEOJO ROAD ADJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020040LOCAL AUTHORITY PRIMARY SCHOOL, OLODI APAPAOLODI APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020041LOCAL AUTHORITY PRIMARY SCHOOLII, AMUKOKOAMUKOKOPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020042MUSLIM NURSERY AND PRIMARY SCHOOL, AWODI ORAARAROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020042MUSLIM NURSERY AND PRIMARY SCHOOL, AWODI ORAAWODI ORAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020044NAWAIR-UD-DEEN PRIMARY SCHOOL I, AIYETORO, AJEGUNLETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020045NAWAIR-UD-DEEN PRIMARY SCHOOL II, AIYETORO, AJEGUNLETOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020046NEW PRIMARY SCHOOL, ARAROMIARAROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020047OGUNLADE PRIMARY SCHOOL I, ALABALAGOSPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020048OGUNLADE PRIMARY SCHOOL II, ALABAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020049OKOROGBO PRIMARY SCHOOL, OKOROGBOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020050OLADIPO PRIMARY SCHOOL I, OKE-OJAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020051OLADIPO PRIMARY SCHOOL II, OKE-OJAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020052OLANIYONU PRIMARY SCHOOL, ALABAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020053OLODI-APAPA PRIMARY SCHOOL, OLODI-APAPAOLODI-APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020054OLUWA PRIMARY SCHOOL, ARAROMI IARAROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020055OREMEJI PRIMARY SCHOOL I, OLODI APAPAAJEROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020056OREMEJI PRIMARY SCHOOL II, OLODI-APAPAOLODI-APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020057ORODU PRIMARY SCHOOL, AJEGUNLE- ORODUAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020058RESERVATION PRIMARY SCHOOL, OLODI-APAPAOLODI-APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020059SARI-IGANMU PRIMARY SCHOOL I, OKE -OJAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020060SARI-IGANMU PRIMARY SCHOOL II, OKE-OJAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020061SEA BREEZE PRIMARY SCHOOL, OLODI-APAPAOLODI-APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020062ST. JOHN ANGLICAN PRIMARY SCHOOL, ARAROMI, APAPAARAROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020063ST. MARY R.C.M. PRIMARY SCHOOL, AJEGUNLEAWODI ORAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020064SURU PRIMARY SCHOOL, AJEGUNLEAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020065TOLU PRIMARY SCHOOL, OLODI-APAPAOLODI-APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020066UNITY PRIMARY SCHOOL, OWODI- ORAAWODI-ORAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020067WOWO PRIMARY SCHOOL, OLODI- APAPA0LODI APAPAPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020068ZUMRATUL ISLAMIYYAH PRIMARY SCHOOL I, ALABAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020069ZUMRATUL ISLAMIYYAH PRIMARY SCHOOL II, ALABAAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020070ZUMRATUL ISLAMIYYAH PRIMARY SCHOOL, AJEGUNLE 1AAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020071ZUMRATUL ISLAMIYYAH PRIMARY SCHOOL, ARAROMI IIARAROMIPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020078MARK CHI CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020088TOPFIELD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020091DE-KINGDOM GROUP OF SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020095DE-FOLREM NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020100ESTHER PRECIOUS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020105GOD OWN'S FOUNDATION NURESERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020107SOLUTION GATE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020108REVIVAL GROUP NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020108REVIVAL GROUP NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020109ST. ANDREWS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020111ACCOMPLISH NUSERY AND PRIMARY SCJHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020113ZING ZAM CREST NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020114RETENTIVE MEMORY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020124FOLA PRECIOUS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020126WORD OF FAITH GROUP OF SCHOOLSAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020132ZOE TUTELAGE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020141HINDS' FEET NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020142DARUL - IDAYAH ISLAMIC NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020144DARULFIKIRIL NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020155ACS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020159SCHOLARS INTERNATIONAL ACADEMYOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020160BODNUS INTERNATIONAL SCHOOLSAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020161IZZUDEEN ARABIC/ ENGLISH NURSERY AND PRIMARY SCHOOALAFIA STREETPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020162GREEN LIGHT NURSERY AND PRIMARY SCOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020163CUBIC PRIVATE NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020150GLOFOUND PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020213DON & STAR NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020214DE-LIGHT INTERNATIONAL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020215C & C PROGRESSIVE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020218GUIDE TO SUCCESS NURSERYN AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020220REALISTIC GOALS NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020224AL-QAMAR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020226JULEWUBI FOUNDATION SCHOOLSAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020168JED ANIKE CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020171IBADULLAH ISLAMIC SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020172THE LORDS DIVINE VISION NURSERYAND PRMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020173SOLAND INTERNATIONAL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020177REX NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020178SMART BRAIN ACADEMYOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020183TABERA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020187DYNAMIC POWER NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020189ST. DAVILLA SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020192ATHAKOFY ISLAMIC FOUNDATION COMPREHENSIVE COLLEGEAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020192ATHAKOFY ISLAMIC FOUNDATION NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020194STARLINK NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020200EKUM NURSERTY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020202ALKITAB NURSERY AND PRIMARY SCJHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020205SKC NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020206FAITH MODEL NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020229UMBRELLA NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020230HOPE CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020231COMMISIONED NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020232YEMWAB NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020234ARISE AND SHINE INTERNATIONAL NUSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020237FOLABEY CHILDREN SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020238CEB NERSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020239GREAT AGNES NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020240GROOMING KIDDIES NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020241CHILDRIGHT MONTESSORI NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020242CHYLUCK PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020243MARY SLESSOR MODEL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020244SALVATION NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020248BLESSED CHILD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020249JOSAKIN NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020252DE-RIGHT NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020256CORDY ROOT FOUNDATION NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020257SHALOM FOUNDATION NURSERY AND PRIMARY SCHOOLOLODI APAUPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020258ST. JOHNSON KIDDIES ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020262HIGH SPEED ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020264ONLINE CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020266FIRST FOUNDATION NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020268GOVOT KIDDIESAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020270CHITO NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020271AL-MUSTAQEEM ACADEMY NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020273ABOLUSODUN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020275HELIFEST NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020276ADEWURA NUR/PRI SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020278LIGHT SUCCESS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020283SALAFIH NURSERY AND PRIMARY SCJHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020286ARUMEK NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020295DARUL QURAN FOR ISLAMIC AND ARABIC FOUNDATIONAJEGUNLEPRIVATEISLAMIYYAECCE AND PRIMARY
AJEROMI-IFELODUN24020299CHRIST FOUNDATION NURSERY AND PRIM,ARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020300KIDS ACADEMY LESSONOLODI APAPAPRIVATECONVENTIONALECCE ONLY
AJEROMI-IFELODUN24020307FUNTEX NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020309ERINT PRIVATE SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020310FESTLAD COLLEGEMURI OJORAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020315EMMY KIDDIES NURSERY AND PRIMARY SCHOOLAJEROMIPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020317DIAMOND HEROES ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020320POWER OF GOD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020326NEW HAPPY FIELD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020327TOYIN NUSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020335PRIME GOLD NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020337AR-ROSHIDEEN PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020343TINA STARTRIGHT PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020345DARUL -HULUMI ISLAMIC SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020347FAITH NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020351BAPTIST SHINING STAR NURSRY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020353TAWAKALITU ISALAMIC SCHOOL NURSERY AND PRIMARYAJEROMIPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020356LUMINOUS MODEL COLLEGEAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020358DADOCRYST MISSION SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020359OWHENAMA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020360SUPREME LIGHT ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020366GINAJAY NUSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020373TOS - FADUN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020377LUMINOUS CHILDREN SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020378KIDSCARE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020380PAT EMMA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020383JODEB CHILDREN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020385LIN-DAVES NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020387CITADEL OF EXELLENCE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020393REAL SHEPHERD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020395GRACE OF GOD CHILDREN SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020399FUTURE PILLARS PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020405LEEJEN BLESSED SCHOOL OF SCHOOLSAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020406JOLBAK NURSERY AND NURSERY SCHOOLALODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020408GLORIOUS NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020417GALILEE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020424LAFEK NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020426DISCIPLE SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020428IKPE PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020429VICTORY PROGRESSIVE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020434CHUZZA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020440XSTAR CHILDREN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020445DUKE AND DUCHESS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020447MIVARA CHILDREN SCOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020450GUD-PEN PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020451EDEKO NUSERY AND PRIMRY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020456GRACE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE ONLY
AJEROMI-IFELODUN24020458LOGIC SPRING EDUCATION CENTREAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020459TENDERMATE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020461OLUMADE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020462CHRIST MARVELOS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020465FIRST BAPTIST NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020468BUSY KIDS INTERNATIONAL NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020469BLOSSOM KINGS INTERNATIONAL SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020471JOVY JOE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020476SAADAT NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020477RESTORATION NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020478LIFELIGHT NURSERY AND PRIMARY SCHOOLAJEROMIPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020485MORKAZ-NURULILLAHI NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020486PRINCE FOUNDATION SCHOOLOLODI-APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020490DAYSTAR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020496JUELO NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020500CLEAN CONSCIENCE MODEL SCHOOLSAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020502ZION NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020504MISLAJ PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020506DEEP FOUNTAIN SCHOOLSOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020507QUEEN CARE GROUP SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020508GRACE JOHN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020509SOLUTION NUSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020510PEEVEEKS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020512RIMA LEARNING FIELD PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020516CHRIVBEET NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020518AUNTY WURA PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020525DAMMY GROUP PF SCHOOLSAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020526FUNLAJ NURSERY AND PRIMARY SCOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020533BRIGHT HOPE PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020538ROCK FOUNDATION NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020539GANNIE'S CHILDRENS SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020541OYEWOLE NUSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020544YASIN PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020556NOSIRULHAQ NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATEISLAMIYYAECCE AND PRIMARY
AJEROMI-IFELODUN24020558GOSPEL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020564BLAVOUR CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020568BETHANY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020570HOSSANA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020572BRIGHT DUKE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020574GESTOR NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020580MAC DENNIS NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020581FIRST ACADEMIC FOUNDATION NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020589GOD'S ORDAINED NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020592SUNFAB COLLEGEAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020601OHAYA INTERNATIONAL SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020602SEND THE LIGHT CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020604GOD'S MERCY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020608WORD OF FAITH NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020611JESJA PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020612GODS FAVOUR KIDDIES ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020614JAPPAC INTERNATIONAL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020615RUTHEL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020624PERCUILAR CHILD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020625MARYOLA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020630SUCCESS BASEAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020635DIVINE INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020637LADY B DAY CARE NUSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020643DORBLESS CHILDREN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020645KATHERINE MEMORIAL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020648FUHUMILHUDA ISLAMIC NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN240206511ST D' EKO INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020654BEST UPDATE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020654UPDATE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020659EMAR PRIVATE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020661FOUNTAIN FOUNDATIONAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020665RUBBIES AND GOLD NURSARY AND PRIMARY SCHOOLSAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020666REAL BRAIN POINT NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020667AMINA MODEL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020670PEARL PRIVATE NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020671ELITE NURSERY AND PRIM ARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020683GIVIC TUTORIAL CENTREAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020687DIVINE DESTINY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020690OMOSUYI NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020692GREATER HARVEST NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020694EARLY BIRD SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020695BLESSED CHILD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020697AL-BALAGH CHILDREN 'S SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020699FUNKALAS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020700OMO NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020701GRACE TOWER NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020704ALKAWTHAR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020710AREWA NURSERY AND PRIMARY, GRAMMAR SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020712BONA NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020714IMMACULATE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020715GLORY GATE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020716OLUWA ROYAL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020718ADIKA MEMORIAL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020719AL-FAWAZ ISLAMIC NURSERY AND PRIMARY SCHOOLUGBEWANKWO STREETPRIVATEISLAMIYYAECCE AND PRIMARY
AJEROMI-IFELODUN24020722DORCAS MEMORIAL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020728UNITED PATEC NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020737MOONLIGHT COLLEGEOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020740DAYSPRING PROGRESSIVE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020742ABEBI NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020745OLU UNIQUE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020748OJUOLAPE AKANNI BASIC SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020753SAM AND KELECHI NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020755PEEKAY NURSERY AND PRIMARYSCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020759EXTRAREAL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020764GOODNEWS NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020764KAD - MANUEL NURSERY AND PRIMARY SCHOOLAJAGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020766EQUIN NUSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020781CARO FAVOURED SCHOOLS (CRECHE NURSERY AND PRIMARY)AJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020782BOSMA NURSERY AND PRIMARYB SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020783GREAT ST. JOHN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020787AUSTAC CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020789FAVOUR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020794LA -PRIMA INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020808RUDAN NURSERY AND PRIMARY ASCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020809INFANT JESUS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020810ASSEMBLIES OF GODOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020811ANGLICAN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020813WUMI NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020814PECUILAR INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020815FAMOUS NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020819IBADULAHI ISLAMIC SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020831DELFAY NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020832HAPPY WORLD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020833GRACE AND PEACE NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020834NEWLIFE WINNERS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020839AL-IFADAT ISLAMIC NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATEISLAMIYYAECCE AND PRIMARY
AJEROMI-IFELODUN24020841MORE BLESSING NURSERY AND PRIMARY SCOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020842MOTHERMARY CATHOLIC NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020848INTEGRITY TOP STAR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020849DIVINE ACADEMY NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020873AJIF COMPUTER CENTRE SURU 131 OJO RD, AJEGUNLEALABAPUBLICCONVENTIONALPRIMARY ONLY
AJEROMI-IFELODUN24020874HOME ECONOMICS CENTRE, ALABA OROAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020874GOLDEN CROWN NURSARY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020875AJIF CENTRE MOSAFEJO-AMUKOKOAMUKOKOPUBLICCONVENTIONALPRIMARY ONLY
AJEROMI-IFELODUN24020876LOCAL AUTHORITY NURSERY/PRIMARY SCHOOL AMUKOKO IBAMUKOKOPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020878ROLEX CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020879GRAPET NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020880EXCELLENT INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020881FRESH DEW NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020882MORIT NURSERY/PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020883DOMINION CHILDREN ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020884KINGS-SAT MODERN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020886FAITH FOUNDATION NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020887DEZELS KIDS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020888THE WAY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020890ST. BARNABAS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020891CHRISTOS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020892ANGLICAN ACADEMY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020913THE GREAT KING ZION MONTESSORI SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020914GRACIOUS MIND CHILDRENAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020916SUCCVIC STARS NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020917FAITHFUL GOD KIDDIES ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020918GREAT CHILD NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020920ZION ANGLICAN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020921ROSE FOUNTAIN ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020923WINICYNTH NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020925AVILLA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020926GREAT SUCCESS LEARNING VILLE NUR AND PRI SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020927PRISNOB MODEI NUR/PRI SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020928DAVIC FAVOURED NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020933ART & CRAFT CENTREAJEGUNLEPUBLICCONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020936KILMORE NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020937BELOVED CHILD NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020938WORLD MERCIFUL SCHOOLALAFIA STREETPRIVATECONVENTIONALECCE ONLY
AJEROMI-IFELODUN24020939JOLA NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020942RUTADEF NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020943LIFE PRIVATE SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020944PAKUN-OLA NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020945TOLYFUN INTERNATIONAL SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020947TOP KID NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020949DIDANE FAVOUR NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020950GOOD TIDING ACADAMYAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020951NURULLAH CHILDREN SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020952RILIABLE NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020953HOME ECONOMIC CENTREARAROMIPUBLICCONVENTIONALPRIMARY ONLY
AJEROMI-IFELODUN24020954COJEP NURSERY AND PRIMARY SCHOOLAJEROMIPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020955RISING STARS NURSERY AND PRIMARY SCHOOLOLODI-APAPAPRIVATECONVENTIONALECCE ONLY
AJEROMI-IFELODUN24020956CHIDOS NURSERY AND PRIMARY SCHOOLOJOKUPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020957GOD'S VESSEL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020958GREAT LEADERS NURSERY AND PRIMARY SCHOOLOJOKU STREETPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020959TOP CLASS KIDDIES ACADEMYOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020960FAMOUS DEE ACADEMY NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020961AJIF MINI RESOURCE CENTRE ARAROMIOLODI-APAPAPUBLICCONVENTIONALPRIMARY ONLY
AJEROMI-IFELODUN24020962FAMOUS GARDEN NURSERY AND PRIMARY SCHOOLAJEROMIPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020963STEPPING STONE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020964APATA FOUNDATION INTERNATIONAL SCHOOLOLODI-APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020967RIGHTVIEW NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020970PEGLO NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020971FUTURE LEADER FOUNDATIONAL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020972KNOWLEDGE MODEL NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020973FLOURISH ROSE NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020993AJEROMI IFELODUN COMPUTER CENTRE, EBENENZER COMPLEX, AWODI - ORAAWODI - ORAPUBLICCONVENTIONALPRIMARY ONLY
AJEROMI-IFELODUN24020994BRAVE HEART COMPREHENSIVE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020996EVERGREEN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020997GREAT ACHIEVERS NURSERY AND PRIMARY SCHOOLAMUKOLOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020998AMEN CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24020999REBAJAY NURSERY AND PRIMARY SCHOOLAJEGUNLE APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021001BRIGHTEN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021002JAMA'ATUL ISLAMIYAHAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021003SHARE FIELD KIDDIES ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021004SEAT OF WISDOM NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021005CROWN WELL FOUNDATION SCHOOLAJEGUNLE APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021006THE SAMS' MONTESSORIAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021008BRILLIANT CRESCENT NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021009BLOSSOM SEEDS ACADENYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021010CROWN OF SPLENDOUR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021011AS-SULTAAN CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021012GOOD SEED NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021013VIDAF NURSERY AND PRIMARYAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021014FOAUSTIN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021016EMALA COMPREHENSIVEGROUP OF SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021017GOLDEN CHILDREN ACADAMYAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021018SUCCESS ACADAMY NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021020SUCCESS FOUNDATION SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021021DIVINE FINGER SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021022ROSE WELLOMOLOLUPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021023GOD`S WILL NURSERY & PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021033BRIGHTER GENERATION NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021034FAITH GOSPEL GROUP SCHOOL`AJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021035RIGHT TRACK SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021036DIVINE ACADEMY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021037ST. PHILEN'S CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021038ELECT ACADEMY NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021039CROWN FIELD CHILDREN NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021040RUTHEL NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021041ARK OF GOD ACADEMYAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021042GOD'S REST SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021043DE GREAT SAINT LEO NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021045PETVIC PRIVATE SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE ONLY
AJEROMI-IFELODUN24021046DIVINE NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE ONLY
AJEROMI-IFELODUN24021047PERFECT TOUCH NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021048RIDIWANULLAH NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATEISLAMIYYAECCE AND PRIMARY
AJEROMI-IFELODUN24021050AN-NUR NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATETSANGAYA/ALMAJIRIECCE AND PRIMARY
AJEROMI-IFELODUN24021051AL-HAQQAH NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATETSANGAYA/ALMAJIRIECCE AND PRIMARY
AJEROMI-IFELODUN24021052AS-SALAM INTERNATIONAL SCHOOLAJEGUNLEPRIVATETSANGAYA/ALMAJIRIECCE AND PRIMARY
AJEROMI-IFELODUN24021053GRACIOUS MIND CHILDREN SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021054SANTAM'S NURSERY AND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021055UNIQUE CHILD SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021057DORA NOCH PARAGON SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021058PRINCE AND PRINCESS INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021113MAVIR FOUNDATION NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021114EARLY STAGE NURSERY AND PRIMARY SCHOOLOLODI-APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021117LIGHT AND TRUTH INTERNATIONAL SCHOOLSOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021118OJIKUTU MEMORIAL GRADES NURSERY AND PRIMARY SCHOOLOLODI APAPAPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021120DAARUS-SUNNAH NURSERY AUND PRIMARY SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
AJEROMI-IFELODUN24021122RAH SAD NURSERY AND PRIMARY SCHOOLAMUKOKOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030001ABARANJE NURSERY & PRIMARY SCHOOL II, ABARANJEABARANJEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030002ABARANJE NURSERY & PRIMARY SCHOOL, ABARANJEABARANJEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030004ABATI NURSERY & PRIMARY SCHOOL, AKOWONJOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030004ABESAN NURSERY & PRIMARY SCHOOL, ABESAN, IPAJATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030005ABORU NURSERY & PRIMARY SCHOOL, ABORUTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030006AFRICAN CHURCH PRIMARY SCHOOL, AKOWONJOAKOWONJO, EGBEDAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030007AFRICAN CHURCH PRIMARY SCHOOL, IKOLA 3IKOLAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030008AFRICAN CHURCH PRIMARY SCHOOL, MEIRAN-AJASAMEIRAN-AJASAPUBLICSPECIAL NEEDSECCE AND PRIMARY
ALIMOSHO24030009AFRICAN CHURCH MODEL NURSERY/PRIMARY SCHOOL II, ALAGBADOALAGBODOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030010AFRICAN CHURCH NURSERY/ PRIMARY SCHOOL II, MEIRANMEIRANPUBLICSPECIAL NEEDSECCE AND PRIMARY
ALIMOSHO24030011AFRICAN CHURCH PRIMARY SCHOO I, ALAGBADOALAGBADOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030012AFRICAN CHURCH PRIMARY SCHOOL, MOSAN, IPAJAIPAJAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030014AKOWONJO NURSERY/PRIMARY SCHOOL,AKOWONJO ALIMOSHOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030014ALAGUNTAN NURSERY/PRIMARY SCHOOL, ALIMOSHOIYANA-IPAJAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030015ALIMOSHO NURSERY/PRIMARY SCHOOL, ALIMOSHOALAGUNTAN-IYANA-IPAJAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030016ANGLICAN NURSERY & PRIMARY SCHOOL, AYOBOJAGUNDEYI TOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030017ANGLICAN NURSERY/PRIMARY SCHOOL, AKESANAKESANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030018ANU-OLUWAPO PRIMARY SCHOOL, OKE-ODOOKE ODOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030019ARMY CHILDREN NURSERY/PRIMARY SCHOOL, ABULE-EGBATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030020ATEGBO NURSERY AND PRIMARY SCHOOL, IKOTUNTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030021COMMUNITY NURSERY & PRIMARY SCHOOL II, EGANEGANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030024COMMUNITY NURSERY AND PRIMARY SCHOOL I, IKOTUN 2TOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030025COMMUNITY NURSERY AND PRIMARY SCHOOL, IPAJAAYOBO IPAJAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030026COMMUNITY NURSERY AND PRIMARY SCHOOL, ISERI-OLOFINEGBEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030027COMMUNITY NURSERY AND PRIMARY SCHOOL, ISHEFUN1-3IDIMUPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030027COMMUNITY NURSERY AND PRIMARY SCHOOL, ISHEFUN1-3TOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030027COMMUNITY NURSERY AND PRIMARY SCHOOL, ISHEFUN1-3OBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030028COMMUNITY NURSERY AND PRIMARY SCHOOL, MEIRANMEIRANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030030COMMUNITY NURSERY AND PRIMARY SCHOOL, SURULERE-ALAGBADOALAGBADOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030031COMMUNITY NURSERY AND PRIMARY SCHOOL, ILAPOILAPOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030032COMMUNITY NURSERY&PRIMARY SCHOOL I, EGANEGANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030033COMMUNITY NURSERY/PRIMARY SCHOOL, AMIKANLE 2AMIKANLEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030034COMMUNITY NURSERY/PRIMARY SCHOOL, OKE-OkO, IPAJAAYOBO IPAJA BARUWAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030035COMMUNITY PRIMARY SCHOOL ISHERI OLOFINIDIMUPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030037COMMUNITY PRIMARY SCHOOL II, IKOTUNTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030038COMMUNITY PRIMARY SCHOOL OKE-ODO, ALIMOSHOOKE ODOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030039COMMUNITY PRIMARY SCHOOL, ABULE EGBATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030040COMMUNITY PRIMARY SCHOOL, OBADAREAKESONPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030041EBENEZER AFRICAN CHURCH NURSERY AND PRIMARY SCHOOL, OKUNOLA EGBEDAEBEDAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030042EGBEDA NURSERY AND PRIMARY SCHOOL, EGBEDAEGBEDAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030043ESTATE NURSERY AND PRIMARY SCHOOL, ABESAN, IPAJATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030044HOUSING-ESTATE NURSERY AND PRIMARY SCHOOL IPAJATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030045IFESOWAPO NURSERY & PRIMARY SCHOOL, ABORUTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030047LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL I, ALAGBADOALAGBADOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030048LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL I, IKOTUNTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030049LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL II, AGBADOAGBADOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030050LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL II, EGANEGANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030051LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL II, IGANDOIGANDOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030052LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL, EGBEIDIMUPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030054LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOL, IKOTUNTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030055LOCAL GOVERNMENT PRIMARY SCHOOL I, EGANEGANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030058LOCAL GOVERNMENT PRIMARY SCHOOL, OKE-ISHAGUN/IKOLAOKE-ISAGUNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030059LOCAL GVERNMENT PRIMARY SCHOOL I, IGANDOIGANDOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030060METHODIST NURSERY AND PRIMARY SCHOOL, IGBOGILI, IPAJAIGBIGILI IPAJAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030061NURSERYUDEEN ADEWALE NURSERY & PRIMARY SCHOOL, SURULERE-ALAGBADOSURULEERE-ALAGBAD0PUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030062OKERUBE NURSERY AND PRIMARY SCHOOL I, ABARANJE, OKERABARANJEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030063OKERUBE NURSERY AND PRIMARY SCHOOL II, ABARANJEABARANJEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030064OKI PRIMARY SCHOOL, ALIMOSHOABULE OKIPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030065OLOFIN NURSERY/PRIMARY SCHOOL, AKESANAKESANPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030066OLUKOTUN NURSERY AND PRIMARY SCHOOL, IKOTUNTOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030067OORE-OFE NURSERY AND PRIMARY SCHOOL, EGBEEGBEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030068RAUF AREGBESOLA NURSERY AND PRIMARY SCHOOL, ABATITOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030069SALVATION-ARMY NURSERY AND PRIMARY SCHOOL I, AYOBO-IYABAALIMOSHOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030070SALVATION-ARMY NURSERY AND PRIMARY SCHOOL II, AYOBO IPAJAAYOBOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030071SASA NURSERY & PRIMARY SCHOOL, ALIMOSHOSASAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030072ST GEORGES UNA PRIMARY SCHOOL IPAJATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030073ST. ANDREWS ANGLICAN NURSERY & PRIMARY SCHOOL, IPAJAAYOBO IPAJA BARUWAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030074TEMIDIRE NURSERY AND PRIMARY SCHOOL, OKE-ODOOKE ODOPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030075UNITY NURSERY AND PRIMARY SCHOOL, EGBEEGBEPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24030078VIVAVOCE GIFTED SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030083DE BEST FOUNDATION AKA KOVIC PRIVATEIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030088DEBUK NURSERY AND PRIMARY SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030111ASHIPA SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030116DAFEG CHILDREN ACADEMYTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030116DAFEK NURSERY AND PRIMARY SCHOOLAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030129MUSLIM COMMUNITY NURSERY AND PRIMARY SCHOOLIPAJAPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24030133PALMVILLE CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030139ROYAL PRIDE MONTESSORI SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030144FOURSQUARE NURSERY AND PRIMARY SCHOOLAMOSUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030167MOSINMILOLUWA SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030184HIGH HOPE MONTENSSORI NURSERY AND PRIMARYOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030187ROZBAN CHILDREN FOUNDATION SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030207EXCLUSIVE MUSTARD NURSERY AND PRIMARY SCHOOLAGBELERALEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030209MARV GRACE COLLEGEABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030239GOS'S WILL INERNATIONAL SCHOOLILAPOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030266YUNUS MODEL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030280ELIBEL INTERNATIONAL SCHOOLABESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030282LTB NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030301GOD'S LOVE NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030305BLENA PENIEL NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030307TOEYIN NUR &PRY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030313YOUNG STARS NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030339KECEED PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030340MIMI PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030354DE-AMAZING GRACE NURSERY AND PRIMARY SCHOOOLEGBE /IKOTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030363BELOVETH SUCCESS FOUNDATION SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030371BENESTHER NURSERY AND PRYMARY SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030371FORELAND SCHOOLSABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030381LEADWAY INTERNATIONAL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030389BRAZEN WALLS NURSERY AND PRIMARY SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030390TRILLIUM M.D NURSERY AND PRIMARYSCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030402MANDATE PRIVATE NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030404EBUN HERITAGE FOUNDATION SCHOOLSEGBE IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030406SHESFUN PRIVATE SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030427GREAT KINGDOM NURSERY AND PRIMARYAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030430ROYAL PRIESTHOOD NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030437REFORMER SCHOOLSEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030481DEE JEWEL NURSERY AND PRIMARY SCHOOL GOWON ESTATE EGBEDATOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030486PATFIN NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030522PEACE MEMORIAL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030531OLABMO PRIVATE SCHOOLOBAD0REPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030536MERRY KIDDIES NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030537HAPPYDAM MONTESSORI NURSERY AND PRIMARY SCHOOLABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030537THE FRONTLINERS NURSERY AND PRIMARY SCHOOLSHASHA AKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030541ANCHOR MIRRORS NURSERY AND PRIMARY SCHOOLABESAN ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030542ALPHA REHOBOTH MONTESSORI SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030566AL-HAQQ NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030569IKE-OLUWA INTERNATIONAL SCHOOLOKERUBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030577PHILADAM NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030581DE PARADISE CHILDREN SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030581DE PARADISE CHILDREN SCHOOLIGANDUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030582FPP NURSERY & PRIMARY SCHOOLEGBEDA- IDIMU ROADPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030586ANGELHALL INTERNATIONAL SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030593IBIYEMI PRIVATE SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030597DAMOOL INTERNATIONAL SCHOOL NURSERY AND PRIMARYOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030600AFFABLE SCHOOLS (NURSERY & PRIMARY)0KERUBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030606ST GLADYS PRIVATE SCHOOLSUBERU OJE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030612FLOURESCENT INTERNATIONAL NURSERY AND PRIMARY SCHOOLMOSAN, IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030613ANOINTED TO EXCEL SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030615FREMOS PRIVATE SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030649AT- TAWAB NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030668COMET PRIVATE SCHOOLIKOLA ILUMOHPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030676TUNYO NURSERY SCHOOL ANNEXEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030678JACFA NURSERY AND PRIMARY SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030691BBIC NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030694JULES PRIVATE SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030694JULES PRIVATE SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030707DATTOS ACADEMYIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030732ST. LAWRENCE NURSERY AND PRIMARY SCHOOLAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030738AWODOYIN MEMORIAL PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030739BOLS INTERNATIONAL NURSERY AND PRIMARY SCHOOLAKIN OGUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030741A SQUARE NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030751MERCY NURSERY AND PRIMARY SCHOOLABULE-MOOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030773KINGDOMPEARLS INTERNATIONAL SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030780BIDEM NEW DIMENSION NURSERY AND PRIMARY SCHOOL0KE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030781UNIQUE HERITAGE MODEL SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030782CHIAMAKA SCHOOLS KG NURSERY & PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030789JOYMANUEL NURSERY AND PRYMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030791ROT MARY MONTENSSORI SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030792JAMOF GROUP OF SCHOOLSALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030794DORKIEL NURSEY AND PRIMARY SCHOOLCELE VILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030812DAROS BEE PRIVATE SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030816ABOVE ALL GROUP OF SCHOOLSEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030817FOLADOT NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030818JUBILANT NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030822RAINBOW EARLY LEARNING CENTERTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030823MUSLIM UNITY SCHOOLIDIMUPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24030830DE BERT HAPPY HOME SCHOOLAJEGUNLE ILOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030832AMSA INTERNATIONAL SCHOOLAJEGUNLE ILOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030839DAYSTAR NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030866FESSOT PRIVATE ACADEMYEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030873CORONET SCHOOLSMEIRAN LAGOSPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030877SUCCESS GATE SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030879MAFAZAT PRIVATE SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030881PACEY MANUEL SCHOOLSOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030883MAO NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030887OMOTILOYE NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030889NEW BLOOM NURSERY & PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030904BURROUGH LEARNING SCHOOLOKUNOLA EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030933UNICE NURSERY AND PRIMARY SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030961TULSA HOME FOUNDATION SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030963TOPFAB NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030969FAR SIGHT SCHOOLALARO MEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030980LAFON NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030986OASIS OF GRACE SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030991NAWAIR UD DEEN NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24030992SUCCESS PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24030996SKYOP NURSERY AND PRIMARY SCHOOLABULE -A EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031007CONNER STONE CHILDREN SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031008BACHEL GROUP OF SCHOOLSIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031009PROLIFIC SCHOOLSMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031033DE OSAS SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031038PENUPS NURSERY AND PRIMARYSUBERU OJE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031063UPPER CHAMBER SCHOOLSOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031064HEPHZIBAH GLORIOUS CHILDREN PRIVATE SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031065ROLL ON NURSERY & PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031071NETAD PLUS NURSERY ANDM PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031072GREAT REDEEMERS NURS AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031085ST APEX GROUP OF SCHOOLSAGBADO OKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031086MOLAYO CHILDREN SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031102BOSRAH FAVOR SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031105FIRST CHOICE SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031108SAMEC NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031118FENT HERITAGE PRIVATE SCHOOLILO AJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031119EBUN HERITAGE FOUNDATION SCHOOLSAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031122SWEET HOPE GROUP OF SCHOOLSAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031154NURUDEEN NURSERY AND PRIMARY SCHOOLAKINTAN-MEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031158SWEET VALLEY COLLEGETOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031166OLUWALADE GROUP OF SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031168SOUNDHOPE FOUNDATION SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031204SHALOM NEWBREED SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031205MARCTOS KIDDIES NURSERY AND PRIMARY SCHOOLEGBE-IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031209HANDS OF GOD NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031213GREAT MINDS INTERNATIONAL SCHOOLSALIMOSHOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031214GOD'S TOWER NURSERY AND PRIMARY SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031223OSBOT ROYAL SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031246GLORIAL INTERNATIONAL NUIRSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031247D AND D NURSERY AND PRIMARY SCHOOLAGBENAJE IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031265CHRISKEM NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031268GLOBAL KIDDIES NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031275SAINT LOUIS NUR AND PRY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031276PAGRRIFS YOUNG STARS PRIVATE SCHOOLEGBE- IKOTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031278PRECIOUS AND PRINCESS KIDDIES ACADEMYIKOTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031285IPAJA BAPTIST NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031286MAXFEM INTERNATIONAL NURSERY AND PRY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031297WISDOM NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031299INSP INTED ACADEMYTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031306KING JOSIAH MIGHT NURSERY AND PRIMARY SCHOOLAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031315RHOSAAC INTERNATIONAL PRIVATE NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031324ST VINCENT CATHOLIC SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031326TRIUMPHANT ACADEMYSHASHAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031332CHRISTLEAD NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031337FEM GLORIOUS OPRIVATE SCHOOLABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031347PRINCE OF GLORY NURSERY AND PRIMARY SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031350VICSOLKEM NURESRY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031353FOUNTAIN OF HOPE NURSERY AND PRIMARYIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031375CERULEAN ACADEMYIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031376SUCCESS INTERNATIONAL SCHOOLOKUNOLA EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031377GLAD TIDINGS NURSERY AND PRIMARY SCHOOLABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031383GREAT HANDS OF GODEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031420ST MARK'S PRIVATE SCHOOLOKERUBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031421GRACIOUS NURSERY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031430MOSTSACRED HEART NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031442EMMANUEL CHILDREN SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031443FOLUTOP PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031449DANCOM NURSARY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031455GOD'S HERITAGE SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031473FOSAB SECONDARY SCHOOLALIMOSHOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031475AL-BARR MONTESSORI SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031482FELYKRIS PRIVATEIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031495MERCY-WAY INTERNATIONAL SCHOOLSHASHAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031496MUSLIM ASSOCIATION OF NIGERIA NURSERY AND PRIMARY SCHOOLSHASHA BAMEKE AKOWONJOPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24031515RUESAB PRIVATE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031516EUCHARISTIC HEART OF JESUS MODEL NUR/PRY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031532GRACE BELL NUR/PRY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031535GOD'S OWN NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031537M&M PRIVATE SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031549SILVER SPRINGS SCHOOLSABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031562CROWN PRIVATE SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031569KEMSY SCHOOLS NURSERY AND PRIMARYOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031572JAH'S GLORY SCHOOLSAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031585THE POTTER INTERNATIONAL SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031591BIMFEM PRIVATE SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031592GOSHEN PRIVATE SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031600FAITH NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031600FAITH NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031602ALL SENSES SCHOOLCOMMAND IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031603NAZAD SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031611LIZBEN PRIVATE SCHOOLSURULERE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031638REWARDING FIELD NURSERY AND PRIMARY SCHOOLIDIMU-EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031648ROTS INTERNATIONAL SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031657BETNIO ROYAL SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031666DEE VIRTUOS KIDS ACADEMYCELE VILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031672ANGELS FIELD MONTESSORI SCHOOL, NO. 33 OLAJIDE AGBOOLA ST., HARMONY ESTATE, ABOTUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031697SUNBEAM NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031726TOP MOST INTERNATIONAL NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031739GREAT REVELATION SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031741DELBEN NURSERY AND PRIMARY SCHOOLFASAYO STREET, OFF VULCANIZER SASA ROADPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031774FIRST CLASS COMPREHENSIVE SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031775KERAS SECONDARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031776JIRO HIGHER ROCK PRIVATE SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031807TRIPLE B NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031811BOPTON NURSERY AND PRIMARY SCHOOLCAPTAIN OLOTAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031818SUPREME CHILDREN SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031823HALL OF FAME ACADEMYAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031827EBU FIELD SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031830SUBULUN-NAJAAT NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031831GOD DIVINE INTERNATIONAL SCHOOLAGBENAJE IKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031836OYINLADE MODEL SCHOOL NURSERY AND PRIMARYSCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031856BENVIC PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031871CISTO NURSERY AND PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031882CONVENANT PRIVATE SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031882JJUPERQS COVENANT PRIVATE SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031883COVENANT PRIVATE ACADEMY NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031890MARYJOE MONTESORY SCHOOLALASOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031891HOPE OF GLORY PRIVATE SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031911DE-COVENANT HERITAGE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031942GOD WILL NURSRY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031949ROYAL INTERNATIONAL SCHOOLBARUWA-IYANA IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031952FIRST APEX MONTENSSORI NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031964WATERED GARDEN SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031964WATERED GARDEN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031965MESSIAH CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031968DEFAITH PRE NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031969HIGHER LIFE INTERNATIONAL SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031978PAR EXCELLENT NURERY AND PRIMARY SCHOOLAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031979CHRIST THE SAVIOUR NURSARY AND PRIMARY SCHOOLGOWON ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031982PLUMERIA NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031983FRONTLINE GROUP 0F SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031985PECULIAR CHILDREN SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24031995KINGSFIELD SCHOOLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032005DEBOMAT PRIVATE SCHOOLAMIKANLEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032009MUBARAK MONTESSORI SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032013TAOHEED NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032014GREAT FAITH ALIVE SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032022ESTIM CHILDREN SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032025PATTYNATH NURSERY AND PRIMARY SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032026ELEGANT NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032036THE VESSLE OF HONOUR COMPREHENSIVE COLLEGEAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032039GOOD SHEPHERD COMPREHENSIVE HIGH SCHOOLMEIRAN/OMOROGAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032039MARVELOUS NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032057FRUITFULEDEN NURSARY SCHOOLOBADOREPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24032061JONIANGELS NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032067WISDOM POINT ACADEMYMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032069SHERRY COCO ANGELS NURSERY AND PRIMARY SCHOOLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032071ADE GOSHEN NURSETY AND PRIMART SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032090KIDDZZ PENN SCHOOLMOSAN-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032093ADDASHOM INTERNATIONAL GROUP OF SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032095TITUSJANE HIGH SCHOOLAGBELEKALE,ABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032100GOLDY HEROES PRIVATE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032112AUNTY REMS INTERNATIONAL SCHOOLSHASHAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032118A&B SCHOOLSMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032118K&B SCHOOLSCELE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032132OLAK NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032138PACESETTERS ACADEMYMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032148VALIANTMINDS MONTESSORI SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032152AUNTIE FOLA NURSERY AND PRIMARY SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032153TENNY NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032155ELGINAL NURSERY & PRIMARY SCHOOL, NO. 30 OLAOGUN STREET, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032156KEMIA NURSERY AND PRIMARY SCHOOLMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032159JAF COMPREHENSIVE COLLEGEIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032174SAINT MICHAEL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032177MERCY LAND ACADEMYOPEKIPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032180ROSHALLOM NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032186ST. MICHAEL NURSERY & PRIMARY SCHOOLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032194FORTUNE PRIVATE SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032199WISDOM FIELD NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032203LIVING SEED COLLEGEOLOTA ABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032212DELA MOG PREPARATORY NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032232ST DANIEL NURSERY AND PRI MARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032238ADUNOLU NURSERY AND PRIMARY SCHOOLAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032243MISAM INTERNATIONAL SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032244ROYAL AMBASSADORS SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032247FOLEM HIGH SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032262DIVINE CARE SCHOOLSAGBENAJE IKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032262DIVINE CARE SCHOOLSOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032263MARYLAW INTERNATIONAL COLLEGETOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032265INTESIDA NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032268BEMA INTERNATIONAL SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032268BEMA INTERNATIONAL SCHOOLSETTLEMENTPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032277SHALOM NURSERY/ PRIMARY SCHOOLS IKOTUNAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032281DIVINE FAVOUR NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032282EDIFY INTERNATIONALM SCHOOLSAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032285BLESSED ASSURANCE INERNATIONAL SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032288BEFUNM NURSERY AND PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032301PREMARVEL NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032310GOD'S GLORY NURSERY AND PRIMARY SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032322E AND J SCHOOLSAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032324MOLUGRACE NURSERY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032325OLLY SQUARE CREATION NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032326REMARKABLE STEP NUR & PRY SCHOOLISOTOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032328EVATON SCHOOLABULE-EGBA.AGBELEKALEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032333AYINKE MOSES ODUTOLA ACADEMYIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032358IBRAHKINS COMPREHEMNSIVE COLLEGEEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032359GODLEADS NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032360HENDAVE SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032363KINGDOM HERITAGE MODEL SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032366GOLDEN CROWN ACADEMYIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032367OMOYE INTERNATIONAL SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032371QUEEN MARIS GROUP OF SCHOOLSEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032373GOD'S WILL NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032375JESAN DIVINE NURSERY PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032376MICZANRIA CHILDREN SCHOOLALAS0PRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032382LAWFIIDEL NURSERY AND PRIMARY SCHOOLISOTOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032383BRAINFIELD MONTESSORI SCHOOLABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032388SAINT BENEDETH NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032398SIMMIC NURSERY AND PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032404TOBOS INTERNATIONAL MODEL N/P SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032407SILVERDALE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032417DIRANMEMORIAL PRIVATE NURSERY AND PRIMARY SCHOOLAMJE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032423BHORAH INTERNATIONAL SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032426NATIONS PRIDE GROUP OF SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032427GRAND SCHOOL, EGANEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032428BEMA COMPREHENSIVE HIGH SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032434MERCYCHILS JUNIOR ACADEMYAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032435SAMDEB PRIVATE SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032435SAMDEB PRIVATE SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032446QODESH SCHOOLSIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032460GOLDEN REAPING SCHOOL INTERNATIONAL EGBEDATOWNPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24032464MOOFT PRIVATE SCHOOL NUURSERY AND PRIMARYIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032466ALLOVER SCHOOLSAMJE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032467TONYLAND NURSERY AND PRIMARY SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032468EL-CRYSTAL STAR SCHOOLIGAND0PRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032480PRINCE 0F GLORY CHILDREN SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032487KINGSVILLE NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032495DENSTER PRIVATE SCHOOLISOTOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032501LAI MEMORIAL NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24032505MARYJANE NURSERY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032512DAYSPRING NURSERY/PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032520HIGH GATE NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032527PRIMAGE NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032529RHOLAK NURSERY AND PRIMARY SCHOOLAJASA C0MMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032538CRYSTAL FONDA SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032548DE CITADELOF FAITH INTERNATIONAL NURSARY AND PRIMARY SCHOOLORELOPE, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032551CHRISMEON NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032553GREAT GRACE NURSERY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032560GOLDEN READING NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032561T & Y PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032563YETTABEL NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032564DREAMREALITY NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032576VISSION SUNRISEMEIRANPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24032581LIVINCHRIST PRIVATE SCHOOLSURULEREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032586BALALA SCHOOLCAPTAINPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032589MERCY OF GOD NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032590KINGSLAND MONTESSORI SCHOOLMERIANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032591WONDER CHILDREN NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032593PRAISE OLUOMA NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032604REDEEMED NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032609DIVINE GRACE NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032611SOUNDMINDS NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032618AFOD GRANDVILLE NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032619OMOLOLA BRAINY ACADEMYMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032630GEORGE MICHAELS SCHOOLAJASA COMMANDPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032632ABLE-GOD NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032643GREAT MOUNT ZION NURSERY & PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032643GREAT MOUNT ZION NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032653ANOINTED NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032657PACESETTER NURSERY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032657TUDELL ACADEMYMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032658FOLUDAS DIVINE FAVOUR PRIMARY SCHOOLMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032664PROGRESIVE PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032669ABSOLUTE FOUNDATION NURSERY AND PRIMARY SCHOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032680OLUWATOSIN NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032689FOLLYBOLS NURSERY AND PRIMARY SCHOOL, IFESOWAPO, ABORUTOWNPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24032693THE GRACE PATHFINDER NURSERY AND PRIMARY SCHOOL2017PRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032696NISTECH MONTESSORI SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032699CANI SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032703GOODHEAD NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032711ST DANIEL NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032751HAVLLA FORWARD NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032759ABRAHAM INTERNATIONAL SCHOOLAJEGUNLE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032763PRECIOUS SAVOUR INTERNATIONAL SCHOOLAMJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032767AN-NUR PRIVATE SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032774BENRO PRIVATE SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032777DE SUNSHINE INTERNATIONAL SCHOOLAJEGUNLEPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24032785ELIAS INTERNATIONAL SCHOOLSOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032789AYOOLA NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032795MATORIA NURSERY AND PRIMARY SCHOOLEGBE IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032799TOLUWANI NURSARY AND PRIMARY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032802FIBOF INTERNATIONAL SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032802FIBOF INTERNATIONAL SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032814TOMLARK PRIVATE SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032819GOODNESS AND MERCY NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032824CALEB CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032830REGALZ PRIVATE ACDEMY NUR PRY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032836EMMYCORD NURSERY AND PRIMARYAYETOBIPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032846ETERNAL JOY MONTESSORI SCHOOLALIMOSHOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032861JOKE AYO INT'L SCHOOL (NUSERY AND PRIMARY)ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032863KEMMIC NURSERY AND PRIMARY SCHOOLIDIMU ITUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032865HIGH RISE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032875RENICS SCHOOLSEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032879ANSAR-UD DEEN NURSERY AND PRIMARY SCHOOLBARUWA AYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032887CANDID PRIVATE NURSERY AND PRIMARY SCHOOLEGBE IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032889T&M MONTEESSORI SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032892BAMAKA INTERNATIONAL SCHOOLSABESAN ESTATE (IPAJA)PRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032894THE SPRING OF LIFE NURSERY AND PRYMARY SCHOOL ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032904PRECIOUS MUSLIM SPROUTS SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032905ROSE VILLE COLLEGEMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032910GREAT MUSTARDS SEED NURSERY AND PIMARTY SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032911UNICORN GROUP OF SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032918TOYEK TRIUMPH COMPREHENSIVE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032921PEARLY GATE NURSERY AND PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032931TOLAYOPE'S NURSERY AND PRIMARY SCHOOLOLOTA ABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032938ORLAND PRIVATE SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032944ZODIAC NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032950MASTERPRIDE PRIVATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032960BLESSED INTERNATIONAL SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032963TOSMOL SCHOOLSABESAN-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032970PRECIOUS VICTORY NURSERY AND PRIMARY SCHOOLAGODO EGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032978DUPEOLU CHILDRENLAND SCHOOLUNITY ESTATE, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24032980GRACE FILED CHILDREN SCHOOLMOSANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033000RIGHT STEP SCHOOLAGODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033006FVS PRIVATE SCHOOLSIYANA-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033008ZION SPRING NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033015GLORIOUS KIDS NUR/PRY SCHTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033041GLOBAL EXCELLENCE NURSERY AND SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033056BUDAYAH NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033067LERATO INTERNATIONAL NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033070PLATFORM MONTESSORI SCHOOLAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033071CAROMOS ARK CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033073DIVINE CONFIDENCE SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033087FLOSAN NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033093OMAANS NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033109TAMAR PRIVATE SCHOOL IIGANDOIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033117CLEVELAND NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033134LEGACY PREPARATORY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033136ROYAL TOTS SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033137SHELOY DAY NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033139AWARD INTERNATIONALNURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033143KAEMSELS NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033151FOLLY DEE MONTENSSORI SCHOOLIYANA-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033153HONEYFAAB SCHOOLABESAN-OMUSUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033172DE MORDERN PACE SCHOOLSIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033175DE HOME'S SCHOOLSEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033185EASY FLOW NURSERY AND PRIMARY SCHOOLMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033191ETERNAL KING SCHOOLSAMJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033193CONVENANT NURSERY AND PRIMARY SCHOOLEKOROPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033198MORALITY NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033203AL-FURQAN JUNIOR ACADEMYMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033215MIDLAND NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033220DIVINE STARS MONTESSORI SCHOOLABESAN, IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033231ELITE NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033239RAPID GROWTH NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033244PASSIONFIELD MONTESSORI SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033261DEE UNIQUE INTERNATIONAL NURSERY AND PRIMARY SCHOOLABISI VILLAGE ABESAN ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033272EVERGROWING NURSERY AND PRIMARY SCHOOLSIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033279THE HOLLIES SCHOOLIKOTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033281HONEY BEST ACADEMY (HBA)TOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033284TRANSFIGURATION CITADEL NURSERYB AND PRIMARY SCHOOLMEIRONPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033302LADUNMERCY KIDDIES SCHOOLMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033306HOME LAND CHILDREN SCHOOLSMAIRAN,ALIMOSHOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033320ST MIKOS NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033345FERSCOAT NURSERY AND PRIMARY SCHOOLOLUDE-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033355HAVANAH NURSERY AND PRIMARY SCHOOLIGANDO IKOTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033361HIS MERCY NURSERY AND PRIMARYAJEGUNLE ILOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033368THE GODS WILL NURSERY AND PRIMARY SCHOOLBAMEKEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033370ABBA RABBI SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033372CHOSEN CHILDS SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033376VICKAZ KIDDIES SCHOOLAJEGUNLEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033379KANMI NUR/PRY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033409MASTERGUIDE SCHOOLEGBEDA/AKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033416LITTLE ANGEL NURSERY AND PRIMARY SCHOOLOKE - 0DOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033420EAGLE'S TOWER NURSERY & PRIMARY SCHOOL, PLOT 8-14 CORNELIUS NZEBUKA STREET, FHE, AGO 40, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033421NATION BUILDERS SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033426MCJANHILL PRIVATE SCHOOLMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033433ULTIMATE PRIDE ACADEMYALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033435SPRINGING SEED MONTERSSORI SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033436WABIM PRIVATEMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033444GOD'S TIME ACADEMYIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033466BASHAN INTERLLIGENT ACADEMYAJEGUNLE ALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033476MOZAN SCHOOLS NURSERY AND PRIMARY SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033492DE COMFORT CHILDREN SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033493OMOTAYO NURSEY AND PRIMARY SCHOOLABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033499MAMRE GROUP OF SCHOOLSALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033501JAGUAR NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033519EMMAWE[ PRIVATE SCHOOLMIERANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033547HONEY LAND SCHOOL SAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033556TOAMY NURSARY AND PRIMARY SCHOOLGOWON ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033565MULTIGRACE NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033569AUNTY BIM NURSERY AND PRIMARY SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033571EDANA MONTESSORY SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033573ADEMI NURSERY AAND PRIMARY SCHOOLAJASAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033575ASO LAND NURSERY AND PRIMARY SCHOOLSHASHAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033584AR RASHEED NURSERY AND PRIMARY SCHOOLATAPAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033595SPECIAL GRACE NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033597CLEVERHALL PRIVATE SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033601KING DAVID NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033606ROYAL GATE CHILDREN SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033611PRECIOUS LIFE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033614AL LATEEF NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033621DALTOP HAVILLAH GOLD NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033625BAQIS SPRINGFIELD SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033628HIS WAY GARDEN NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033629B ZONE MUSLIM COMMUNITY NURSERY AND PRIMARY SCHOOLMOSAN, IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033631KRISBETH NURSERY AND PRIMARY SCHOOLAKINOGUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033635B J K BEAUTY NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033641SPRING STARS PRIVATE SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033642CEYOL INTERNATIONAL SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033643WHITE HOUSE INTERNATIONAL SCHOOLMOSANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033661ESTATE BAPTIST CHURCH NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033668GREENAPPLE SCHOOLMOSANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033696PRIME TOUCH COLLEGEIGANDUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033700REAL PRIVATE SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033702SINGLE GATE CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033716EVELYN MEMORIAL NURSERY AND PRIMARY SCHOOLMOSAN, IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033721DE-LINKS NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033747PRECIOUS INFANT NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033752HEPHZIBAH TOTAL CHILD ACADEMY AKINOLA ABBORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033754LARRYKEM NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033779SKYLIGHT NURSERY AND PRIMARY SCHOOLIKOLA ILUMOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033785KIKE NURSERY AND PRIMARY SCHOOL, PIPELINE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033786MAYPRIDE NURSARY AND PRIMARY SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033787MASTARED NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033807FAVOUR LAND INTERNATIONAL SCHOOLAMJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033811TOPTUNS NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033817LILY PRIDE NURSERY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033818QS DAYSTAR PRIVATE SCHOOLSAGRIC ROAD, EGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033824FUTURE SCHOLARS SCHOOLMEIRANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033829DE-PEMA-GIFT SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033830SAMETIFAVOURED CHILDREN SCHOOLGOWON ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033832LITTLELIGHTS SCHOOLGOWAN ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033833SOPHEM NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033844WORD OF POWER NURSERY & PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24033852BEJIDE MEMORIAL COLLEGEISHERI OLOFINPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033853multi victory nursery and primary schoolELE- EPOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033855EXCEL IMMACULATE SCHOOLGOWON ESTATE EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033857TOAMY HILL SCHOOLGOWON ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033873KONSOL NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033877JUNIS PRIVATE ACADEMYIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033880MIC ROYAL NURSERY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033923HOME ECONOMIC CENTER OKE ODOOKE ODOPUBLICCONVENTIONALPRIMARY ONLY
ALIMOSHO24033923TUNADEX PRIVATE SCHOOLABULA - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033924DE-MARTHAABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033924STARGATE INTER SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033926AGGREY MEMORIAL NURSERY AND PRIMARY SCHOOLABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033927BEARING SEED INTL SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033927EXCELLENT FAITH BILINGUAL SCHOOLSABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033929EXCEEDING GRACEOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033930BLEEMA NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033931BEN-BOLMARKS SCHOOLSABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033931GRAET BAHOMUS NUR/PRY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033932AS-SAAADAH NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033932BENRIT INTERNATIONAL SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033933ALIMOSHO TEACHERS' RESOURCE CENTREOKIPUBLICCONVENTIONALPRIMARY ONLY
ALIMOSHO24033933VICTORYPATH GROUP OF SCHOOLABLU EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033934HOME ECONOMICS CENTREOKIPUBLICCONVENTIONALPRIMARY ONLY
ALIMOSHO24033934RAFAUS ACADEMYABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033935KIYINFA NURSERY AND PRIMARY SCHOOLABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033936PRIESTHOOD CHILDERN SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033937ABYTOY SCHOOLSMOSANPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24033938WIZZY PRIDE SCHOOLMOSANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033939LEARNING ROOTS ISLAMIC SCHOOLMOSANPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24033940PVADET NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033941THE BLESSED KIDDIES NURSERY AND PRIMARY SCHOOLMOSANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033943COMETH CHILDREN SCHOOLABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033943MAIN SEQUENCE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033945GODLEADS OUR WAY MONTESSORI SCHOOLABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033945TOKEM NURSERY AND PRIMARY SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033946GOD VISION NURSERY AND PRIMARY SCHOOLIKOLAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24033947RAPID RESULTS NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033947RUTHWIPHDALE NURSERY AND PRIMARY SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033948FORTUNE BASE NURSERY AND PRIMARY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033948MEILLEUR BESG CHILDREN SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033949ADEMUST NURSERY AND PRIMARY SCHOOLAJEGUNLE ILOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033953VOCATIONAL (SCIENCE ) CENTRE ABULE-EGBATOWNPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24033955JESLUV MONTESSORI NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033958RS NURSERY AND PRIMARY SCHOOLABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033961SITO GOD'S TIME NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033963NEW MARK NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033964OCEAN SPRING N/P SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033965EXCELLENT ROCK NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033966TITA SECONDERY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033967KLIFFON NURSERY AND PRYMARY SCHHOLAYOBOPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24033969ADEX PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033970GREAT GRACE PRIVATE NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24033971DE MAINGATE MODEL SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033972LIFETIME COMPREHENSIVE N/P SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033992DEBBY SUND MONIESSORSOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033994OLU'S MERIT GROUP OF SCHOOLS, PIPELINE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033996JOSAB NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033997TOPMAS INTERNATIONAL SCHOOLSABULE - EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24033999BRIDGE INTERNATIONAL ACADEMY ORE MEJI EKOPOMEIRONPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034000COMMUNITY VOCATION CENTER IKOTUNTOWNPUBLICCONVENTIONALPRIMARY ONLY
ALIMOSHO24034001SHALOM NURSERY & PRIVATE SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034001STEADFAST NURSERY AND PRIMARY SCHOOL IKOTUNTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034002GPLF ISLAND SCHOOLSTOWNPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24034002VICTORIOUS CHILDREN SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034003COMPUTER CENTERALAGBADOPUBLICCONVENTIONALPRIMARY ONLY
ALIMOSHO24034003ABIOLU NURSERY AND PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034005BI IDHNILLAHI CHILDREN SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034006BIMSTAR NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034007ABLE GOD SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034008THE ROCK NURSERY AND PRIMARY SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034010TOBASE INTERNATIONAL SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034010TOTADAM JUNI0R NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034011AMOS PRIVATE SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034011ROYALINK SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034012JURADAT MEMORIAL SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034013TALENT LINK JUNIOR ACADEMYIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034015TUNS OYE INTERNATIONAL SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034016BILCOST NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034019JOHN IDEAL ACADEMY NURSERY AND PRIMARY SCHOOLAPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034020ROYAL PATH NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034021DYNAMIC NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034023EDULAND SCHOOLS, AKOWONKOTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034026AMIABLE PREPARATORY SCHOOLVILLAGEIPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034029TREASURE NURSERY AND PRIMARY SCHOOL IKOTUNTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034030JIMALOK NURSERY AND PRIMARY CSHOOL IKOTUNTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034033DEBI-C NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034035HIGH CLASS COMPREHENSIVE HIGH SCHOOL IKOTUNTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034036LEADERFIELD ACADEMYTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034037SCOOBY DOO NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034038HOPES BALLAD SCHOOLTOWNPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034039DAILY PASSION IMMACULATE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034041DESTINY KIDS NURSERY AND PRIMARY SCHOOL IKOTUNTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034042HAPPY BETTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034043APPIAN WAY SCHOOLSEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034045AL-MUFLIHUN NURSERY AND PRIMARY SCHOOLUNITY ESTATE, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034047COMMUNITY PRIMARY SCHOOL, SASABAMEKE, SASAPUBLICCONVENTIONALECCE AND PRIMARY
ALIMOSHO24034048ALIMOSHO COMPUTER CENTREEGBEDAPUBLICCONVENTIONALPRIMARY ONLY
ALIMOSHO24034049SALSABIL NURSERY AND PRIMARY SCHOOLISIBA STREET, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034050DOVE MONTESSORI NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034051PHIDEL NURSERY AND PRIMARY SCHOOLSELIAT, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034053PLEASANTLAND SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034055FESBACH NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034056JONIC NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034057HEBRON CRECHE AND PRE-SCHOOLIPAJAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034058HIGH TREE NURSERY & PRIMARY SCHOOLOKUNOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034059KIDDIES STAR HERITAGE SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034060EASYSTEPS SCHOOLAKINYELE, IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034061TREASURE SEARCH CHILDREN'S SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034065GODGUIDE NURSERY AND PRIMARY SCHOOLMOSANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034068GREAT GLIDE SCHOOLSEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034070BAMBINO SCHOOLSIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034084DONRAPH NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034086JANET MEMORIAL NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034087PAVIC INTERNATIONAL NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034090TREASUREBASE NURSERY AND PRIMARY SCHOOLISHERI-IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034091REAL HIS GRACE PRIVATE SCHOOLISHERI OLOFIN IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034092ARUTH PRIVATE SCHOOLISHERI OLOFINPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034096THE GOLDEN CITY PRIVATE SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034099ELYON NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034102TCC TESTIMENT SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034103PATHWAY CRADLE VINE ACADEMY NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034104GLATET NURSERY AND PRIMARY SCHOOLAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034105LUBCON VILLA NURSERY AND PRIMARY SCHOOLAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034106BRITE HILL SCHOOL BARUWA AYOBO IPAJAAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034107DIVINE TREASURE NURSERY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034108RIZBAK NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034109KIDDIES GLORYLAND SCHOOLAYOBO IPAJA CARDOSO RD. BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034111DALGATE NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJA BARUWAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034112NEW RABBONIC SCHOOLSBARUWA AYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034114DEMMY CRYSTAL MONTESSORI SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034115FRUITFULLAND DIVINE HERITAGE NURSERY AND PRIMARY SCHOOL.IKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034116THE LIFE INTERNATIONAL SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034118KINGDOM UNITY SCHOOLIPAJA NEW LAYOUTPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034119VIGOROUS VINE SCHOOLIPAJAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034120SUPERB EDUCATION FOUNDATION SCHOOLIYANA-IPAJAPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24034121PVADET NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034122KINGDOM -SCHOOLS MONTESSORIIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034123VITLAND NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034124AL-IMAN NURSERY & PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034125SUNSHINE NURSERY & PRIMARY SCHOOL, NO. 13 SEIDU TORIOLA STREET, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034127BFET HOMEZONE SCHOOL, 16 OLUSEGUN AJORIN STREET, HILLTOP ESTATE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034128JOAN-ISRAEL SCHOOL, BLOCK 56, PLOT 1353, OFF ALUKO AKINGBADE STREET, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034129DANDEB NURSERY & PRIMARY SCHOOL, HILLTOP ESTATE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034131BRIGHT FUTURE NURSERY & PRIMARY SCHOOL, NO. 2, CHURCH STREET, AKINGBADE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034133WIGATAP NURSERY & PRIMARY SCHOOL, ALUKO FIELD ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034135DATA VILLE NURSERY & PRIMARY SCHOOL, NO. 2, ANTHONY OTI STREET, OPP. ALUKO FIELD, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034136HEPHZY HEROES SCHOOLS, NO. 43 AKINGBADE STREET, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034137AJOPRAISELIM NURSERY & PRIMARY SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034138CLICK LAND NURSERY & PRIMARY SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034139TRAFALGAR NURSERY & PRIMARY SCHOOL, NO. 1 TRAFALGAR CLOSE OFF ADEGBOLA AYOOLA ST. AGO 40, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034142ARTISLAND SCHOOLS, NO. 60 WALE FAMUTIMI ST., PEACE ESTATE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034146EMMANUEL PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034151ESDAM NUR AND PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034153ST CELINA CHILDREN SCHABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034162JOSTIANA INTERNATIONAL SCHLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034183ALL MERCY SCHOOLSIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034184MOLBUM NURSERYIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034185SUCCESS LAND NURSERY AND PRIMARY SCHOOLMOSAN, IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034186FAVOURED BREED PRIVATE ACADEMYIPAJAPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24034187DANCHRISTABEL SCHOOLEGBEDAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034188PURPOSE KIDDIES SCHOOLMOSAN OKUNOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034189STONEBRIDGE SCHOOLGOWON ESTATE, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034190TAALEEMUL ISLAMEE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24034193MARIESWORTH SCHOOL, NOS. 86/88 WALE FAMUTIMI STREET, PEACE ESTATE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034195ST. CHARLES CHILDREN SCHOOL, NO. 12 ISUA ST. AGBELEKALETOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034196ADVINA NURSERY AND PRIMARY SCHOOL, BLOCK 25, PLOT 600, MERCURY ESTATE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034202PENLAND NURSERY AND PRIMARY SCHOOL, PEACE ESTATE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034204ROSHARON PRIVATE ACADEMY, NO. 22, OLAOGUN STREET, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034205EMM'S MOORE ROYAL SCHOOL, ABORUTOWNPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034206RITA INTERNATIONAL SCHOOL, NO. 8 OLUFEMI ST. PIPELINE, ABORUTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034213SPEED KINGDOM SCHOOLCELEVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034214HIGH TASTE MONTESSORI SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034215COVENANT CHRISTIAN SCHOOLCELE VILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034216BELMIN INTERNATIONAL SCHOOLIYANA-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034218FATHER ABRAHAM INTERNATIONAL MONTESSORI SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034222CHAMPIONS PATHABESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034229HIGHCROFT NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034230MICANNA PRIVATE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034231BOLUWATIFE HERITAGE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034234YEMSOL PRIVATE SCHOOLSEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034236SOMWISE PRIVATE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034237PHENOMVILE MONTESSORI SCHOOLS, EGANEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034245COVENANT TEKNOKIDS DISCOVERY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034246GOLDEN STARS ACADEMYIKOTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034250EVEREST NEWTOWN NUR/PRIIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034251BELLADONNA NUR/PRIMARY SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034253D-DYNAMIC MINDS SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034253GOD ARISE SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034254STADEM INTERNATIONAL NUR/PRI.SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034255TENDER AGE CARE SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034256KROWOL INTERNATIONAL SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034257EDGEMONT INTERNATIONAL SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034259FADEK NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034260AL-MULIK ISLAMIC SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034261SHALON NUR./PRI. SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034261TRUE VIRTUE PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034263VICJODAM PRIVATW SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034264PHILWELL FAVOUR SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034266OLUSEGUN NUR/PRI. SCHOOLIKOTUN IGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034268ST. SAVIOUR'S NURSERY AND PRIMARY SCHOOL SCHOOL, EGANEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034270DADE GROUP OF SCHOOLSEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034272SUN STARS CHILDREN SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034273SARAH'S FAITH INTERNATIONAL SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034277LUTFUMAZ NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034279DIVINE LIGHT SHINING STAR SCHOOLIGANDOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034280DADA OASIS NURSERY AND PRIMARY SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034281MODAK SCHOOLSEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034294SPRINGBOARD SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034297ROYAL PRIEST MONTESSORI SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034304ECHELON SCHOOLSEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034308TESSY BASIC PRINCIPLES NUR/PRY SCHOOLEGBE IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034313DO-ESDOT INTERNATIONAL SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034314GOD'S MERCY NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034316ROYAL KIDDIES NURSERY AND PRIMARY SCHOOLISHERIPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034317ERNAL INTERNATIONAL SCHOOLISHERI OLOFINPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034319REDEEMED GLORY NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034320DE PRINCE AND PRINCESS MONTESSORI SCHOOLISHERI IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034321K&T INTERNATIONAL NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034322DIAMOND HALL SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034323GREENVILLE LIBERTY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034324SIENA PRIVATE SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034325PADEK CHILDREN SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034326ADELEYE NURSERY AND PRIMARY SCHOOLBADA AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034327ATO-FEMS NURSERY AND PRIMARY SCHOOLBADA- AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034328ABORT NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034330WEMLEX GRACE NURSERY AND PRIMARY SCHOOL AYOBOAMULE-AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034331TREASURE HILLS SCHOOL LAGOSAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034332DEE-VICTORY SCHOOLAYOBO VILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034332THE TRUTH VISIONARY MISSION INTERNATIONAL SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034335ST.ANDREWS NURSERY & PRIMARY SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034336REHYAB NURSERY AND PRIMARY SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034340BEGINNERS FIELD NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034342PRECIOUS AND PRINCESS KIDDIES ACADEMYIKONTUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034347DELOL NURSERY & PRIMARY SCHOOLEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034348DE-CITADEL SCHOOLSEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034353GRACIOUS MINDS SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034354EDEN KEN NURSERY AND PRIMARY SCHOOLOKUNOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034355GWAT PRIVATE SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034356BLAZERS SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034358THE RISEN CHRIST SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034359TRUCHOICE MONTESSORI SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034360CHRIST LIGHT SPECIAL MISSION FOR DEAF.EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034361WINTON SMART SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034363FUTURE HOPE GROUP OF SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034364EBE-DEBBY INTERNATIONAL SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034365BEST VIEW NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034372REMROYAL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034373ADONVILLE SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034374QUEENROY NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034375LIVINGSPRING INTERNATIONAL SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034376DEE SPROUT NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034378ONETWOSIX MONTESSORI SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034379BRAIMOT HERITAGE NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034380ALL SAINTS PRIVATE SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034381CHASE GROUP OF SCHOOLS MONTESSORIAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034383DE-FROLIC NURSERY AND PRIMARY SCHOOLLAGOSPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034384MARG-PHIL SCHOOLS LTDOLAYEMI AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034386MOSINMILOLUWA NURSERY AND PRIMARY SCHOOLAMULE-AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034388RARE GIFT MODEL SCHOOLSIGESU-AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034389BENGLARMIR PRIVATE SCHOOLIGESU AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034392ESIRI PRIVATE SCHOOL AYOBOAYOBO-IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034393ALMIGHTY NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24034394BRIGHT CHILDREN SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034395THERESA INTERNATIONAL SCHOOL AYOBOAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034396DICDORA NURSERY AND PRIMARY SCHOOL IPAJAIPAJA-AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034397LAYO NURSERY AND PRIMARY SCHOOLBADA AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034398CROWNED LIGHT ACADEMYAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034400JANE-ROYAL TEMLADAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034405ABBOT DAY SPRING SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034407DE MAINGATE MODEL SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034408PASSWORD NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034410ELIAM PRIVATE SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034411FAPEP GROUP OF SCHOOLSAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034412FRESH FAINTAIN SCHOOLSAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034413HOPE HEIGHTS GROUP OF SCHOOLIPAJA-AYOBOPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24034414UPPERWAY PRIVATE SCHOOL, AYOBOAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034416GODS HANDS NURSERY AND PRIMARY SCHOOLIPAJA AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034417CHRISTY INTERNATIONAL SCHOOLSAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034418LOBAB PRIVATE SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034419GREAT NATIONS AMBASSADORS SCHOOLSAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034420LIVINGSPRING KINGDOM SCHOOLAYOBOPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24034421GREAT WISDOM PRIMARY SCHOOL AYOBOAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034422AL-JAMAH ARABIC AND ISLAMIC INSTITUTEAYOBOPRIVATEISLAMIYYAPRIMARY ONLY
ALIMOSHO24034423SAI-JOY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034424AN-NIWAAR KIDDIES NURSERY AND PRIMARY SCHOOLAYOBOPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24034425PRECIOUS OLIVE NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034426DEE CHEDSEN PRIVATE SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034431JOYLAD INTERNATIONAL SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034432BRIGGS' GATE NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034434CATLAD PRIVATE ACADEMYATAPA IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034435MY DESTINY NURSERY AND PRIMARY SCHOOLIKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034436SOMDIVINE INTERNATIONAL SCHOOLAMIKANLEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034438BESTROYAL MERIDIAN NURSERY AND PRIMARY SCHOOLALAKUKOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034439BAPTIZER SCHOOLAJEGUNLE ILOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034440MAMLAKATUL ILM NURSERY AND PRIMARY SCHOOLAMIKANLEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034441SHADADOM NURSERY AND PRIMARY SCHOOLISOTOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034442MAC OREKS NURSERY AND PRIMARY SCHOOLAGBENAJE IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034453WINSTELL NUR/PRY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034455JPMARYHILLS NUR/PRY SCHVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034456ROYAL HERITAGE NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034457TOWAB PRIVATE SCHOOL,IJEGUNVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034459DIVINE MULTI GRACE COLLEGEIJON/AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034459ZION ZKS NURSEY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034460SEBYS ACEDEMYTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034463VIKKYFIELD SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034464INTELLECTUAL GIANTS EARLY LEARNING SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034465PRIMEWILL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034467DUROSEF PRIVATE SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034468PRAISEGRA NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034469LOYOLA HEIGHTS INTERGRATED SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034470DALIS NUR/PRY SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034472ALICE EMI SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034476REVI NOBLE NUR/PRY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034479TEM FUN NUR/PRY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034480BEST BRAIN GATE WAY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034481GRACE LEAQUE NUR/PRY SCHTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034482BLESS DAVID SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034483TASHMAK NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034485MODEL TOP SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034486SWEET HOPE CHILDREN SCHOOLIKOLEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034493MUSTARD SEED SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034494MONTOS SCHOOLABARANJEPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034498LORDS DIVINE FAVOUR COLLEGEABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034499THE KINGS KIDS NURSERY AND PRIMARY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034513MARVIC MONTESSORI SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034514BUILD UPOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034515GODS MERCY KIDDIESOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034516WORD OF FAITHOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034517PARADISE NUR/PRY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034517STARBREED COLLEGEABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034518THE TRUELIGHTS SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034519FENOLA MONTESSORI SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034520BOLUWATIFE NUR/PRY SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034521BOFAK EARLY LIFE NUR/PRYOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034522HARVARD GATE MONTESSORI SCHOOLOKE ODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034523TOMBEE ROYAL NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034524ESTHERS HAVEN SCHOOLEGBEDAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034525SATILAD NURSERY AND PRIMARY SCHOOLAKOWONJO LAGOSPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034527SPRINGWOOD PREPARATORY NURSERT AND PRIMART SCHOOL.EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034528REMEDY KIDS NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034529FRANCAS CHILDREN SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034530FUTURE FRONTIERS SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034531JESUS FOUNDATION INTERNATIONAL SCHOOLGOWON ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034532JOLLYAGE SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034533MARIGOLD NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034536MIGHTY OAKS NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034537TOWERGATE PRIVATE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034539CITIZENS PRIVATE ACADEMY NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034540CHRISTY SEGE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034541SILVERBIRD ROYAL NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034544TINUOLA PRIVATE SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034546D-PURPLE PEARLS HALLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034547USAMAT NURSERYN AND PRIMARY SCHOOLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034548TABITHA'S PIONEER INTERNATIONAL SCHOOLEGBEDAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034549ADEOLA INTERNATIONAL SCHOOLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034550ABITAJ UNIQUE NURSERY AND PRIMARY SCHOOLEGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034551CORRIANDER NURSERY AND PRIMARY SCHOOLAKINWOWO STREET, IYANAPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034553DE-WYSE NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034554ZERELYN NEWAGE PRIVATE SCHOOLS BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034556POSITIVE LEARNING POINT NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034557MENOSA PRIVATE SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034558CHILD COMFORT NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034559TREE HILLS MONTESSORI SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034560AL-MUFLIHUN MONTESSORI SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034561COVENANT GROUP OF SCHOOLS BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034562MABETTS SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034563GOLDEN WAY NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034565WORTHSVILLE HOME SCHOOLAYOBO IPAJAPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24034567GREAT PLATINUM NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034568ENIGREEN NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034572DESTINED STARS NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034603KINGS ROYAL GENERATION SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034604JOLABELL INTERNATIONAL SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034606ALL NATIONS INTELLECTUAL SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034607BELOVETH HOME SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034608TOP LEARNERS SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034611MARIFEM SCHOOLSALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034623LA-PAIX NURSERY AND PRIMARYSCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034624HE REIGNS SUPREME NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034625POSHBRIT NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034626MARALLEN NURESRY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034629ESTAVILLE INTERNATIONAL SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034632DADA EL-SHADDAI NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034636LUCKYLAND SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034637MJ SPRING FIELDS CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034643DEE- FIRST CLASS PRIVATE ACADEMY BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034644COSMOS NURSERY AND PRIMARY SCHOOLS BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034645GREAT INHERITANCE MONTESSORI NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034647TOPRESH TEE PRIVATE SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034661PINK ROSE NURSERY AND PRIMARY SCHOOL BARUWAAYOBO IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034673KINGDOM BOUND ACADEMYAGBELEKALEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034674EDIFY MONTESSORI MODELABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034675CHRIS - VICOLOTAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034676ST. MAGDOM NUR AND PRY SCHOOLABULE-EGBAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034695EXOTIQUE CHILDREN SCHOOLAGBENAJE IKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034696AR-RISALATUL ISLAMIYYAT NURSERY AND PRIMARY SCHOOLAGBENAJE IKOLAPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24034697PENNYBRIDGE NURSERY AND PRIMARY SCHOOLODUNSI IKOLAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034698REMKAY NURSERY AND PRIMARY SCHOOLIKOLA ODUNSIPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034703ZAYOOLA NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034704GREATER HEIGHTS HERITAGE SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034706SOUND GLOBAL SCHOOLAKOWONKJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034707CHRIST LIFEFORTE SCHOOLSHASHAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034708GREAT JED KIDDIES COLLEGEBAMEKAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034709TANSOL TREASURE SCHOOLIYANA IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034712GOLDEN LEARNERS SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034714FATWINS NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034715MABTAUS NURSERY AND PRIMARY SCHOOLTOWNPRIVATEISLAMIYYAECCE AND PRIMARY
ALIMOSHO24034718RUTH-PEE NUR/PRY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034719LIZY HOPE PRECIOUS SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034753KINS GEM SCHOOLIGBOGILAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034754HOSTEY NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034755FIDEL-ANNE PRIVATE SCHOOLAYOBO VILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034758MAVITO VINE SCHOOLBADA AYOBO LAGOSPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034760AMAZING GLORYOLORUNISOLA IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034761ODUNKEMI FAVOURED INTERNATIONAL SCHOOLBADA AYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034762DAVINA TRUE VINE NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034763DIVINE APPLE MONTESSORI SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034764ONAMADE PRIVATE ACADEMYIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034765CITYTOP SCHOOLSOBO, EGBEDAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034766GLEAMING STARS SCHOOLAKOWONJOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034767JESSEY CHILDREN NURSERY AND PRIMARY SCHOOLIYANAPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034768LUSAN VILLA NURSERY AND PRIMARY SCHOOLIYANA IPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034773GLOBAL LIGHT NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034775JOHNARK BONG SCHOOLSVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034776DOYIN PRIVATE SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034908ROYAL CHILDREN SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24034920GOD'S BLESSING NURSERY AND PRIMARY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035001DEBBYFIELD SCHOOLEJIGBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035002GOMERM NURSERY AND PRIMARY SCHOOLORISUMBAREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035003JONROND NUR AND PRY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035005GODS HILL SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035005OUTPACE MONTESSORI NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035006JOMADE HUDIYAH SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035007SERENA PRIVATE SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035008CRADLE HOME CHILDREN SCHOOLPAIKO IDIMU TITUNPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035009GREAT JED KIDDIES SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035009SOVEREIGN LORD ACADEMYIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035010AMAZING GRACE TALENTS SCHOOLSIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035011ASTUTE ARENA NUR AND PRY SCHOOLABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035011DAMZY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035012COM-BOLA NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035013SHADEB NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035014ACMEAOAKS CHILDREN HOME SCHL(NUR AND PRY)ABARANJEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035014SOLID STONE KIDDIES ACADEMYIDIMUPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24035016FAMIC NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035017DELIGHT BORN GREAT ACADEMYEGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035019REMFAD PRIVATE SCHOOLSIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035022MALAD SCHOOLSIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035023SUCCESS FIELD SCHOOLSIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035024KEMSUN NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035025GRANNA SPRING SCHOOLISHERI IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035026IDM CHILDREN SCHOOLPAIKO IDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035027AL-GHAFFOOR JUNIOR ACADEMYIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035029THE APOSTOLIC NURSERY AND PRIMARY SCHOOLIDIMUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035030TIM-EST PRIVATE SCHOOLAGODO EGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035032ANSWERBANK NURSERY AND PRIMARY SCHOOLAGODOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035034ISADOR NURSERY AND PRIMARY SCHOOLAGODO EGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035037HOKEYKEY MODEL SCHOOLSAGODO EGBEPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035502GREAT CHILD MONTESSORRI SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035503BLESSED AVE MARIA SCHOOLAKESAN IGANDUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035508FAPEG NUR/PRI SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035509HENCHRIS NUR/PRI SCHOOLAKESAN IGANDUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035510TOPBESTOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035515BEN-GRACE NUR/PRI SCHOOLIGANDUPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035519ST. ZITA NUR/PRI SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035522LORD MERCY MILLENIUM ACADEMYAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035523TEMIJIDES NUR/PRI SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035525DYNAMIC ACADEMYAKESANPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24035529BENLAH NUR/PRI SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035532SAMBOL PRIVATE SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035533GOD'S CHOICE SCHOOLAKESANPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24035534ABSORBENT MINDS SCHOOLOBADOREPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24035536ROMIKAZ NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035537DE-ORDAINED FLOMONT SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035538LIFE SAINTS CHAMPION NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035539WHITE SOUL NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035541JASJANE CHILDREN NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE ONLY
ALIMOSHO24035542HONEY BESTACADEMYOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035543NOBLE SYMBALS MODEL NUR/PRIOBADOREPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24035544STELABI SUCCEESS ACADEMYAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035545ADE-GLORYLAND NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035546FOCALAN NUR/PRI SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035547PLEASANT NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24035548AIBOD NUR/PRI SCHOOLAKESANPRIVATECONVENTIONALPRIMARY ONLY
ALIMOSHO24035550GREEN APEX SCHOOLAKESANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035551EXCEL ACADEMYAFOLABIPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035552BEDDENIK PRIVATE SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035553LITTLE P AND P CHILD CAREOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035554SMATAN VILLE ACADEMY NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035555HASBOL NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035556TRIDOBLOM NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035557DE-GRACED CHILDREN NUR/PRI SCHOOLOBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24035777PRECIOUS GLORY SCHOOLAYOBOPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24036238KIDDIES HERITAGE SCHOOLEGANPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24037433DE SUCCESS PRIVATE SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24037434ST. PATRICKS CATHOLIC NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24037435DEE TALENT BELL ACADEMYIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO240374364D NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24037437FADEMORT NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
ALIMOSHO24037441SAM DEBY PRIVATE NURSERY AND PRIMARY SCHOOLIPAJAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN240400012ND AVENUE PRIMARY SCHOOL, FESTACFESTAC TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN240400023RD AVENUE NURSERY AND PRIMARY SCHOOL, FECTACFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN240400034TH AVENUE PRIMARY SCHOOL, FESTACFESTAC TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040004512 RD. PRIMARY SCHOOL, FECTACFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040004512 RD. PRIMARY SCHOOL, FECTACIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN240400055TH AVENUE PRIMARY SCHOOL, FECTACFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN240400067TH AVENUE PRIMARY SCHOOL, FESTAFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040007AMUWO-ODOFIN PRIMARY SCHOOL, AMUWO-ADOFINTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040008ANSAR-UD-DEEN. PRIMARY SCHOOL, ABULE ADOADO SOBAPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040009BISHOPKOJI COMMUNITY NURSERY AND PRIMARY SCHOOLSAGBOKOJI ISLANDPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040010CENTRAL NURSERY AND PRIMARY SCHOOL, KIRIKIRITOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040011CENTRAL PRIMARY SCHOOL, FESTACFESTAC TOWNPUBLICSPECIAL NEEDSECCE ONLY
AMUWO-ODOFIN24040012CHERUBIM & SERAPHIM NURSERY AND PRIMARY SCHOOLIGBO ALEJOPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040013COMMUNITY PRIMARY SCHOOL, FESTAC EXTENTIONTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040014FESTAC PRIMARY SCHOOL, AMUWO, FESTACFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040015IDEAL PRIMARY SCHOOL, FESTAC 3FESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040016IJEGUN EGBA NURSERY AND PRIMARY SCHOOL I, IJEGUN AGBAIJEGUNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040017IJEGUN-EGBA NURSERY AND PRIMARY SCHOOL II, IJEKUN-EGBA SATELITEIJEGUNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040018ITUN-AGAN COMMUNITY PRIMARY SCHOOL, ITUN-AGAN ISLANDITUN-AGAN ISLANDPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040019KUJE NURSERY AND PRIMARY SCHOOL, AMUWO ODFINOLD OJO ROADPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040020LASA UNITED PRIMARY SCHOOL, IIBESHE TOWN RIVERINEIBESHEPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040021LOCAL AUTHORITY NUR & PRIMARY SCHOOL I, AMOWUTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040022LOCAL AUTHORITY NURSERY AND PRIMARY SCHOOL, IBESHE SEA BEACHIBESHE SEA BEACHPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040023LOCAL AUTHORITY PRIMARY SCHOOL, ILASE SEA BEACH (RIVERINE)ILASE SEA BEACHPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040024LOCAL AUTHORITY PRIMARY SCHOOL, I IBASA REVIRINE,IBASAPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040025LOCAL AUTHORITY PRIMARY SCHOOL, IGBOLOGUN VILLAGEIGBOLOGUN ISLANDPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040026LOCAL AUTHORITY NURSERY AND PRIMARY SCHOOL, ILASHE IMOOREILASHEPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040027LOCAL AUTHORITY PRIMARY SCHOOL, IYAGBE ODAN, (RIVERINE)IYAGBEPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040028LOCAL AUTHORITY PRIMARY SCHOOL, KIRIKIRI II, KIRIKIRI TOWNTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040029LOCAL AUTHORITY NURSERY AND PRIMARY SCHOOL, SAGBOKOJI,SAGBOKOJIPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040030LOCAL AUTHORITY PRIMARY SCHOOL, TOMARO-ILADO RIVERINETOMARO ISLANDPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040031NAVY TOWN NURSERY & PRIMARY SCHOOL II, AMUWOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040032NAVY TOWN PRIMARY SCHOOL, AMUWO ODOFINTOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040033NEW TOWN PRIMARY SCHOOL, FESTACFESTAC TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040034OLUMOLE PRIMARY SCHOOL, OLUTI-AGBOJUOLUTIPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040035OYEWOLE NURSERY & PRIMARY SCHOOL I, KUJE MAZAMAZAKUJEPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040036OYEWOLE PRIMARY SCHOOL II, AMUWO-KUJE/MAZA-MAZAKUJEPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040039VICTORY AND PRAISE NURSERY AND PRIMARY SCHOOLSAGBOKOJI ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040044HADEP NURSERY AND PRIMARY SCHOOLIBESHEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040048CUDDLY KIDS NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040061DEBBY DAY CHILDREN ACADEMYKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040064SALVATION ARMY NURSERY AND PRIMARY SCHOOLIGBOESEYOREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040067KINDOM DOMINION MODEL SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040069JUMS EXCEL PRIVATE SCHOOLKUJE AGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040070DE-FUTURE HOPE NURSERY AND PRIMARY SCHOOLONIREKEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040071TREASURE LAND NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040076JUDORA NURSERY AND PRIMARY SCHOOLSATELLITEPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040084GOODNESS NURSERY AND PRIMARY SCHOOLKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040085CHIDAN'S INTERNATIONAL SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040089AUSTINIA NURSERY AND PRIMARY SCHOOLMAZA MAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040096LEADER OF CHILDREN SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040098HIGHLY FAVOURED ACADEMYIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040100JUSTI- JOE NURSERY AND PRIMARY SCHOOLIGBOSEYOREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040105CHAMPION FOUNDATION NURSERY AND PRIMARY SCHOOLABULE OSHUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040107RAPTOP NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040110ELPHIL CRECHE NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040111AN-NAJAT INTERNATIONAL PRIVATE SCHOOLSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040115THANKGOD NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040122CHARIVEST INFANT ACADEMY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040124IDEAL DAY NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040125HIGH TOWER NURSERY AND PRIMARY SCHOOLKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040130ALHIKMAJUL BALIGATPAPOOLA STREET SATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040134DIVINE MERCY NURSERY AND PRIMARY SCHOOLOLUTIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040135HARMONY NURSERY SCHOOLMAZAMAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040136HEPHZIBAH FOUNDATION NURSERY AND PRIMARY SCHOOLKUJE AGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040142MC-DEMAX NURSERY AND PRIMARHY SCHOOLKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040143JADEEN NURSERY AND PRIMARY SCHOOLMAZAMAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040145GRACE ISLAND NURSERY AND PRIMARY SCHOOLIBASA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040146COVENANT KEEPING GOD NURSERY AND PRIMARY SCHOOLMAZA MAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040147THE ODY OF CHRIST NURSERYAND PRIMARY SCHOOLKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040152SHEKINAH INFANT NURSERY AND PRIMARY SCHOOLMAZAMAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040155KINGS FOUNDATION NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040162CLAVONT INTERNATIONAL SCHOOLSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040168BLESSING DIVINE CHILDREN NURSERY AND PRIMARY SCHOOLMAZA MAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040171REALWAY NURSERY AND PRIMARY SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040172FORTUNE DAY NURSERY AND PRIMARY SCHOOLSNAKE ISLAND, IGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040173DANKEM MONTESSORI SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040176CHRIST CHILD ACADEMYMAZAMAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040178LORAL INTERNATIONAL NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040181NOVENA NURSERY AND PRIMARY SCHOOLMONKEY VILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040182DOSEG NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040183NK - SEAT OF WISDOM NURSERY AND PRIMARYKUJE AGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040193MORNING GLORY NURSERY AND PRIMARY SCHOOLMAZA MAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040200HELENCE NURSERY AND PRIMARY SCHOOLAMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040201PRIME MONTESSORI NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040202VOKSEES NURSERY AND PRIMARY SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040205MEEY CHILDREN NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040213KABE NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040214JACOB MONTESSORI NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040217FORSIGHT INTERNATIONAL SCHOOL FESTACFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040219BARBARA COX SCHOOLSFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040222BLISS ACADEMYIBASA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040225VICTORY NURSERY AND PRYMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040231TEHILAH MONTESSORI SCHOOLSATELLITEPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040233LADYWELL PRIVATE SCHOOLIJEGUN IMOOREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040235LAUREATEFIELD MONTESSORI PRIMARY SCHOOLONIREKEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040239TIMEDEB SCHOOLIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040243PECULIAR MONTESSORI NURSERY AND PRIMARY SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040245GODS GLORY INTERNATIONAL SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040246FORTRESS CHILDREN NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040249FIDAM MONTESSORI NURSERY AND PRIMARY SCHOOLABULE OSHUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040259AL- MUTTAQUN NURSERY AND PRIMARY SCHOOLKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040261GRACE FIELD ACADEMYCBN ESTATE SATELITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040270GOOD SEED NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040271STEVEPET ACADEMYIJEGUN SATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040272EBUNTAYO NURSERY AND PRIMARY SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040274PATELLA MODEL SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040280GLODAVIS INTERNATIONAL NURSERY AND PRIMARY SCHOOLOLOTI AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040285SALTHILL NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040287SWEETKIDS NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040291CHRISTHILL CHIDREN SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040296FOURSQUARE LIVING FAITH NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040300DIAMOND AND SAPHIRE NURSERY AND PRIMARY SCHOOLIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040306T J MEMORIAL INTERNATIONAL SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040307LOVING CARE NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040309JOYLAG NURSERY AND PRIMARY SCHOOLIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040311ARCHBISHOP ABIODUN ADETILOYE NURSERYB AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040313DOSEG DAYCARECARE NURSERY AND PRIMARY SCNHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040314A B C, ROYAL NURSERY PRIMARY AND SECONDARY SCHOOLMAZA MAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040315VOISCUM NURSERY AND PRIMARY SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040320ACORNVILLE NURSERY AND PRIMARY SCHOOL CORPORATION ESTSTE AMUWO ODOFINFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040322CONTINENTAL NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040323AS HAABUL JANNAT NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040325REHOBOTH MODEL SCHOOLSIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040327THE BRAINS SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040328BRIGHT CHOICE NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040330FASTRACK INRTERNATIONAL SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040338DIVINE VICTORY SCHOOLSKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040339ROYAL FRAGRANCE SCHOOLSKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040341ASLAM NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040344DE JOAN NURSERY AND PRIMARY SCHOOLMAZAMAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040347PEACOCK SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040349ELIXIR SCHOOLS NURSERY AND PRIMARYSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040350DI'HAYAT RAHIMOTIL ISLAMIC SCHOOLKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040354EXCELLENT SIMMY NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040359J-DAYSPRING SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040360TIPTOPA NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040362CATERFIELD SCHOOLSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040366GREAT NOBEL NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040369WOSEMOUNTNURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040370CRYSTAL COUNTY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040371KAJOLA COMPREHENSIVE GROUP OF SCHOOLSSATELLITE TOWNPRIVATEISLAMIYYAECCE AND PRIMARY
AMUWO-ODOFIN24040375SAJO INTERNATIONAL SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040378ST JUDE`S PRIVATE SECONDARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040381ROYAL CHILD ACADEMYFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040386BRIGHTEST AND BEST NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040387EL-ELYON LEARNING VILLEKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040390DISNEY NURSERY AND PRIMARYSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040392SIMBROOK NURSERY AND PRIMARY SCHOOLABULE OSHUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040394GROOM BRIDGEIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040395SUZYCARE NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040409PAT`S PRIVATE NURSERY AND PRIMARY SCHOOLKUJE AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040412ESISO MEMORIAL MONTESSORI SCHOOLIJEEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040416NURTURE LAND SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040422DR SHOYEMI MEMORIAL NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040423ISLAND ACADEMYIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040429DANVIC LEADERS SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040430SONA NURSERY AND PRIMARY SCHOOLKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040433GAINSVILLE SCHOOLIJEGUN IMOOREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040434HIGHER PASTURES NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040437GREEN FOUNTAIN NURSERY AND PRIMARY SCHOOLKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040440BESTWAY NURSERY AND PRIMARY SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040442PRECIOUS GIFTS NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040446MEDIALILLE ACADEMYKIRIKIRIPRIVATEISLAMIYYAECCE AND PRIMARY
AMUWO-ODOFIN24040462AL-AMEEN NURSERY AND PRIMARY SCHOOLTOWNPRIVATEISLAMIYYAECCE AND PRIMARY
AMUWO-ODOFIN24040466MARFAY NURSERY AND PRIMARY SCHOOLASHOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040473MOUNT MORIAH NURSERY AND PRIMARY SCHOOLKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040480MAGI'S STAR PRIMARY SCHOOLSAGBOKOJI/BISHOPKOJIPRIVATECONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040482SABIS NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040489SUPER STARS SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040498AMUWO ODOFIN MUSLIM COMMUNITY PRIVATE SCHOOLMILE 2PRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040506SOLID ANCHOR MONTESSORI SCHOOLSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040511THE LEARNING FIELD FIELD NURSERY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040512MOTHERS JOY CRECHE AND PLAY GROUPSATELLITE TOWNPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040513SATELLITE TOWN BAPTIST CHURCH,NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040515MEPAC MONTESSORI NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040516CITADEL LEARNING ACADEMYSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040517SMARTVILLE SCHOOLSSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040520PRAISE NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040521REGENT KIDS INTERNATIONAL NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040523AMIRAT SHIREEN NURSERY AND PRIMARY SCHOOLIBESHEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040530GLOBAK PRIVATE NURSERY AND PRIMARY SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040536CATHY ROYAL NURSERY AND PRIMARY SCHOOLSATELITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040537FULL LIFE NURSERY AND PRIMARY SCHOOLIBESHEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040540ELOHIM NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040543FG-VISION BRIGHT NURSERY AND PRIMARY SCHOOLIKAARE SEA BEACHPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040545GLORIOUS ACADEMYIKAAREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040548GLORIOUS BEQUEST NURSERY AND PRIMARY SCHOOLIREDE- MANAGER ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040550GREENPASTURE PRIVATE SCHOOLITUN-AGANPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040551UNIQUE BRIGHTER LIGHT NURSERY AND PRIMARY SCHOOLITUN- AGANPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040553BY HIS GRACE INTERNATIONAL PRIVATE SCHOOLITUN-AGANPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040554YOMTY LEARNING ACADEMYIBESHEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040557WINNING STAR NURSERY AND PRIMARY SCHOOLKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040558KEY TO SUCCESS CHILDREN SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040560IMMACULATE GRACE NURSERY AND PRIMARY SCHOOLKIRIKIRIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040577GLADDENS NURSERY AND PRIMARY SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040579GREATER LAND NURSERY AND PRIMARY SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040581JO- JO KIDDIES SMILES SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040585GOD`S WILL NURSERY AND PRIMARY SCHOOLIMORE IBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040587MACEST NURSERY AND PRIMARY SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040590ROKEY FOUNDATION SCHOOLAGBOJU AMUWOPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040602PEACEFUL NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040603MC GLEE FRANK PRIVATE SCHOOLIBASA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040609CHILD'SRIGHT NURSERY AND PRIMARY SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040612RADIANCE NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040615THE TONSE CHILDREN NURSERY AND PRIMARY SCHOOLIBASA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040618NEW DAWN NURSERY AND PRIMARY SCHOOLIGBOSEYOREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040622DE-PRINCE MUSLIM NURSERY AND PRIMARY SCHOOLIBESHEPRIVATEISLAMIYYAECCE AND PRIMARY
AMUWO-ODOFIN24040624A A INMTERNATIONAL NURSERY AND PRIMARY SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040629NEW FOUNTAIN MONTESSORI CHILDREN SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040630PRETORIA LEARNING ACADEMYSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040637HIGHER HEIIGHTS SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040646CITYPRIDE NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040650HOLY SUPREME NURSERY AND PRIMARY SCHOOLMILE 2PRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040655BLESSED PADISE NURARY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040657SOUND FONDATION PRIMARY SCHOOLIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040660KINGDOM KIDS NURSERY AND PRIMARY SCHOOLSAGBOKOJI ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040661GOD`S LOVE PRIVATE SCHOOLSAGBOKOJIPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040662KINGS CROSS NURSERY AND PRIMARY SCHOOLSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040663FLOWERS OF SHARON NURSERY AND PRIMARY SCHOOLFESTACPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040667PROVIDENCE BILINGUAL NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040668LIVINGSPRING NURSERY AND PRIMARY SCHOOLTOMARO ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040692PROGRESS NURSERY AND PRIMARYFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040693TEACHERS RESOURSE CENTREFESTACPUBLICCONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040694ZUMURATUL ISLAMIYAKUJEPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040695H0ME ECONOMICS CENTREAMUWO ODOFINPUBLICCONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040696MINI RESOURCE CENTRETOWNPUBLICCONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040697C0MPUTER CENTRE FESTACFESTACPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040698ART AND CRAFT CENTRE FESTACFESTACPUBLICCONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040699C0MMUNITY VOCATIONAL CENTREFESTACPUBLICCONVENTIONALPRIMARY ONLY
AMUWO-ODOFIN24040700UNITY NURSERY AND PRIMARY SCHOOL MILE 2TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040701UNIVERSAL NURSERY/PRIMARY EDUCATION FESTAC TOWNFESTAC TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040702SATELLITE TOWN NUR & PRY SCHOOL 1TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040703SATELLITE TOWN NUR& PRY SCHOOL 2SATELLITE TOWNPUBLICCONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040704EAGLE'S VIEW NURSERY/PRIMARY SCHOOL, KIRIKIRITOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040709ANCHORAGE FIELD NURSERY AND PRIMARY SCH00LFESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040711BESCOM INTERNATIONAL SCHOOLIJEGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040714BARTHMOR NUSERY AND PRIMARYSATELLITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040715A I PERFECT CROWN SCHOOLSATELITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040724HEPHZIBAH FOUNDATION NURSERY AND PRIMARY SCHOOLAMUWOPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040728THE BLESSED NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040729WORLD CHANGERS ACADEMYIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040730REDEEMER'S ACADEMYIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040732GIM CORNERSTONE ACADEMY NURSERY AND PRIMARY SCHOOLIGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040733SURE FOUNDATION ACADEMYIGBOESEYOREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040734KINGS NURSERY AND PRIMARY SCHOOLIGBOSHU- IGBOLOGUNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040734VINTAGE PLUS MONTESSORI SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040735GRACE HEIGHTS INTERNATIONAL SCHOOLIGBOSEYORE, SNAKE ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040738DIVINE CHILDREN NURSERY AND PRIMARY SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040739GIVETH LIGHT ACADEMYIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040740STARLIGHT CHILDREN SCHOOLIBASAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040741SALVATION ARMY NURSERY AND PRIMARY SCHOOLIKAAREPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
AMUWO-ODOFIN24040742BRILLIANT SOUND ACADEMYIKAAREPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040744TADSHED ACADEMYITUN-AGAN ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040748GOLDENVILLE NUR/PRI (MONTESSORI)FESTACPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040766PARADISE INTERNATIONAL SCHOOLONIREKEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040767CHILD PRIME ONYX SCHOOLAGBOJUPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040768NEW REALM ACADEMYONIREKEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040770NEW WORLD ACADEMYSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040773TINACARE NURSERY AND PRIMARY SCHOOLMAZAMAZAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040774SAMANKAS NURSERY AND PRIMARY SCHOOLSATELITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040777BLESSED STARS ACADEMYSATELITE TOWNPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040779LITTLE CHERUBS ACADEMYSATELITE TOWNPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040781HAVILAH NURSERY AND PRIMARY SCHOOLMAZA MAZAPRIVATECONVENTIONALECCE ONLY
AMUWO-ODOFIN24040783DIVINE PERFECT CARE SCHOOLSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040784JOYFUL KIDS ACADEMYSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040785STELSTAN ACADEMYIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040786BRAC MONTESSORI SCHOOLIJEGUN EGBAPRIVATECONVENTIONALECCE AND PRIMARY
AMUWO-ODOFIN24040787NOVAS NURSERY AND PRIMARY SCHOOLSATELLITEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050001AJEROMI PRIMARY SCHOOL, BADIA, IJORAIJORA BADIAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050002ANGLICAN PRIMARY SCHOOL, APAPA,MARINE BEACHPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050003APAPA PRIMARY SCHOOL, APAPATOWNPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050004ARAKAN BARRACKS PRIMARY SCHOOL, APAPAAPAPAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050005ARMY CHILDREN PRIMARY SCHOOL, APAPAMARINE BEACHPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050006BADIA PRIMARY SCHOOL, BADIA IRETI-OWSENI SBADIAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050007BAPTIST PRIMARY SCHOOL, AGBEBI, APAPAAPAPAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050008DAVID SAVAGE MEMORIAL PRIMARY SCHOOL, SARI-IGANMU, APAPASARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050009IJORA PRIMARY SCHOOL, IJORA-OLEYEIJORAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050010IRE-AKARI PRIMARY SCHOOL, SARI-IGANMUSARI GANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050011IRE-AKARI PRIMARY SCHOOL II, SARI-IGANMU APAPASARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050012IREPODUN PRIMARY SCHOOL I, SARI IGANMUSARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050013IREPODUN PRIMARY SCHOOL II, SARI-IGANMU APAPASARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050014IRETI PRIMARY SCHOOL, BADIA, APAPABADIAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050015LADILAK PRIMARY SCHOOL, 2, APAPAAPAPAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050016METHODIST PRIMARY SCHOOL, APAPAAPAPAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050017METROPOLITAN PRIMARY SCHOOL, LAPAPASARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050018NANTI COMMUNITYUNITY PRIMARY SCHOOL, NANTI VILLAGE, APAPANANTI VILLAGE APAPAPUBLICNOMADICECCE AND PRIMARY
APAPA24050019OLOJOWON DEMONSTRATION SCHOOL, OKE-OJA, BADIA APAPABADIAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050020ORILE PRIMARY SCHOOL, APAPASARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050021SARI IGANMU PRIMARY SCHOOL, SARI-IGANMUSARI IGANMUPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050022ST. THERESA'S CATHOLIC NURSERY AND PRIMARY SCHOOL, APAPAMARINE-BEACHPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050023STATE PRIMARY SCHOOL, END POINT , APAPAAPAPAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050024UNITED CHRISTIAN PRIMARY SCHOOL, APAPAAPAPAPUBLICCONVENTIONALECCE AND PRIMARY
APAPA24050025GOODNESS NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050026ST THOMAS NURSERY AMD PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050029FOURSQUARE FOUNDATION NURSERY AND PRIMARY SCHOOLIJORA BADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050030HEROS NURSERY AND PRIMARY SCHOOLAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050032BRAIN SHARPENEN INTERNATIONAL SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050034FOUNDATION VICTORTY NURSERY AND PRIMARYN SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050041ALIBRAJ NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050042EARLYDEW NURSERY AND PRIMARY SCHOOLBADIA IJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050043MAKAKEP PRIVATE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050044TUNA TAKE NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050047KIDS MINISTER MONTESSORI SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050049STARLIGHT SCHOOLS NURSERUY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050051KOREDE NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050052AMOVILLE PRIVATE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050059DE SUCCESS ACADEMY NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050060NANCY NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050063JUMAI NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050065ANIMLAHI NURSERY AND PRIMARY SCHOLBADIA IJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050066ECWA NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050071PRAISE PRIVATE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050073PHEVILLE NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050075LORD'S FAVOURITE CHILDREN SCHOOLSARIPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050082ARIKEWUSOLA NURSERY AND PRIMARY SCHOOLIJORAPRIVATETSANGAYA/ALMAJIRIECCE AND PRIMARY
APAPA24050084RIDON NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050086GBEMMY BRIGHT NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050087ABIBOSS NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050090MERCY LAND NURSERY AND PRIMARY SCHOOLIJORA OLOYEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050091OMOLAYO NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050092SOROPTIMIST INTERNATIONAL NURSERY AND PRIMARY SCHOOLAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050096DAWATTUL ISLAM PRIMARY SCHOOLBADIAPRIVATETSANGAYA/ALMAJIRIECCE AND PRIMARY
APAPA24050097AYODELE DAY NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050102ALMUMIN NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050103DIVINE NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050104ALMULIK NURSERY AND PRIMARY SCHOOLORILE IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050107STEVE JEY SCHOOL NURSERY AND PRIMARYSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050110PRESTIGE ACADEMY NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050112BRIGHT STAR NURSERY AND PRIMARY SCHOOLORILE IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050113GODSWISDOM NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050127PRESTIGIOUS PRIVATE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050128GODEN BRAIN CHILDREN SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050129BEDROCK FOUNDATION SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050130LIZ 'B' CAY CARE NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050132ADENIKE NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050135SNAPS INTERNATIONAL SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050141UNIQUE CHILDREN NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050142JORAF CHILDREN SCHOOLIJORA OLOYEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050147ST JOSEPRH NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050151THE MOST HIGH KIDDIES SCHOOLSIJORA OLOYEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050163IMMANUEL ANGLICAN NURSERY & PRIMARY SCHOOLMARINE BEACHPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050167SADEC NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050168FAVOUR NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050169JUM'S NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050170KEEMSON PRIVATE MONJESSORI SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050173AYYUB INTERNATIONAL NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050177CONFIDENCE NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050178DE GRACE NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050184FAITH NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050195SURE STARS NURSERY AND PRIMARY SCHOOLORILEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050197OMOSEHIN NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050198MIFTAUDEEN NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050202BRIGHT SUCCESS NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050203PRISCILLA SCHOOLAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050204DEPARENT NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050206BRIGHT AND MORNING STAR NURSERY AND PRIMARYN SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050207CORONA SCHOOLAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050211JOSSY NURSEERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050212PENIEL PRIVATE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050213SUPREME POWER INTERNATIONAL SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050223HOPE INTERNATIONAL NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050233PEACE SETTER NURSERY AND PRIMARYAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050236SUKURALILAH NURSERY & PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050237RAADIYAT PRIVATE SCHOOLIJORA OLOYEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050239IDEAL EDUCATION FOUNDATION NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050250TADE SCHOOLAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050252GLORYLAND NURSERY AND PRIMARY SCHOOLIJORA BADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050255UNIQUE KIDDIES SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050259HERITAGE DAYCARE NURSERY AND PRIMARY SCHOOLAPAPAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050260ALSOBUR NURSERY AND PRIMARY SCHOOLIJORA OLOYEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050267DE ROCK ROYAL SCHOOLBADIA IJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050268TOLLYGLOW NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050271ST. FRANCIS ROYAL NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050272EARLY CHILD CARE CENTRESARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050273SALVATION NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050274GOLDEN HORIZON NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050277GLORY ACADEMY NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050280FUTURE PRIDE PRIVATE SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050281THE MAINSTREAM ACADEMYSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050283SPANUP NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050285RADEKEM MODEL ACADEMYSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050286LA KREST NURSERY AND PRIMARY SCHOOLORILEPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050288GENAPEC NURSERY AND PRIMARU SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050289PARAGON CHILDREN SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050291GOD'S MERCY FOUNDATION CHILDREN SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050292AL-MAARIFAH GROUP OF SCHOOLSBADIA IJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050293TOPMOST PRIVATE SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050295ANNOINTING ACADEMY NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050296PROMISE LAND NURSERY AND PRIMARY SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050297DE GENIUS SCHOOLSBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050299MORNING STAR NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050300PRIMEBAY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050301BIL HAQ NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050302UNCLE HUSSEYN RIALIABLE NURSERY AND PRIMARY SCHOOLSARI IGANMUPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050303GOVOT ROYAL CHILDREN SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050304ADEX NURSERY AND PRIMARY SCHOOLBADIAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050305BEST STEP FOUNDATION SCHOOLIJORAPRIVATECONVENTIONALECCE AND PRIMARY
APAPA24050306IFAGOG NURSERY AND PRIMARY SCHOOLORILEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060001ANGLICAN PRIMARY SCHOOL, ARADAGUN, BADAGRYVILLGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060002ANGLICAN PRIMARY SCHOOL, GBANKOVILLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060003ANGLICIAN PRIMARY SCHOOL II, IGBOROSUNIGBOROSUNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060004ANGLICAN PRIMARY SCHOOL, ILADO,VILLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060005ANGLICAN PRIMARY SCHOOL, ILOGBO-EREMIILOGBO-EREMIPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060006ANGLICAN PRIMARY SCHOOL, IMEKE IWORO-AJIDOVILLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060007ANGLICAN PRIMARY SCHOOL, IWORO-AJIDO, BADAGRYVILLLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060008ANGLICAN PRIMARY SCHOOL, TOGA-ZANMU, BADAGRYTOGA VILLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060009ANSAR-UD-DEEN PRIMARY SCHOOL, ARAROMI- ALEARAROMI-ALEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060010ANSAR-UD-DEEN SOCIETY PRIMARY SCHOOL, BADAGRYBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060011ARMY CHILDREN PRIMARY SCHOOL, IBEREKO, BADAGRYIBEREKOPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060012COMMUNITY PRIMARY SCHOOL, ESEPE-BADAGRYESEPEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060013EPEME PRIMARY SCHOOL, EPE, BADAGRYEPE-BADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060014GBENOPO PRIMARY SCHOOL, AJARA-TOPA, BADAGRYBADAGRY TOWNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060015LOCAL AUTHORITY PRIMARY SCHOOL, AJARA, ILUDAAJARA VIA BADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060017LOCAL AUTHORITY PRIMARY SCHOOL, OWODE, APAAPAPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060018LOCAL AUTHORITY PRIMARY SCHOOL, BADAGRY, BOEKOHBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060019LOCAL AUTHORITY PRIMARY SCHOOL, IBEREKOIBEREKOPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060020LOCAL AUTHORITY NURSARY AND PRIMARY SCHOOL, IPARAIPARAPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060021LOCAL AUTHORITY PRIMARY SCHOOL, IYAFIN VILLAGE, BADAGRYIYAFINPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060022LOCAL AUTHORITY PRIMARY SCHOOL, KETA-WEST, BADAGRYGBEREFULPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060023LOCAL AUTHORITY PRIMARY SCHOOL, MOWO, BADAGRYMOWO/AGEMOWOPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060024LOCAL AUTHORITY PRIMARY SCHOOL, IWORO-AJIRO BADAGRYVILLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060025LOCAL AUTHORITY PRIMARY SCHOOL, TOPO/IDALE,BADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060026LOCAL AUTHORITY PRIMARY SCHOOL, AKARAKUMO VILLAGEBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060027METHODIST PRIMARY SCHOOL, ASHIPANU, SEME BADAGRYASHIPANU SEME-BOADERPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060028METHODIST PRIMARY SCHOOL, BADAGRYBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060029METHODIST PRIMARY SCHOOL, ENUKOENUKOPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060030METHODIST PRIMARY SCHOOL, EREKITIEREKITIPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060031METHODIST PRIMARY SCHOOL, KWEMEKWEMEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060032METHODIST PRIMARY SCHOOL, SAWAIGBOGBELEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060033METHODIST PRIMARY SCHOOL, TOHONTOHON, BADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060034MOROGBO PRIMARY SCHOOL, MOROGBOM0R0GBOPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060035MUSLIM MISSION COMMUNITYUNIYY PRIMARY SCHOOL,TOWNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060036MUSLIM PRIMARY SCHOOL, BADAGRYBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060037OUR LADY OF APOSTLES PRIMARY SCHOOL, OJOGUNOJOGUN VILLAGEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060038OUR LADY OF APOSTLES PRIMARY SCHOOL, BADAGRYBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060039OUR LADY OF FATIMA PRIMARY SCHOOL, GANYINGBOGANYINGBOPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060040SALVATION ARMY PRIMARY SCHOOL, ANLO-BOGLOANLO-BOGLOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060041SALVATION ARMY PRIMARY SCHOOL, IBIYEIBIYEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060042SALVATION ARMY PRIMARY SCHOOL, IKOTUNIKOTUNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060043SALVATION ARMY PRIMARY SCHOOL, ILOGBO-EREMIILOGBO-EREMIPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060044SEA BEACH PRIMARY SCHOOL, AJIDOVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060045ST. LEO'S CATHOLIC PRIMARY SCHOOL, IKOGAIKOGA-ZEBBEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060046ST. PATRICK (RCM) PRIMARY SCHOOL, IRAGBO/IRAGONIRAGBO/IRAGONPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060047ST. PETER'S CATHOLIC PRIMARY SCHOOL, AGONRINAGONRINPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060048ST. THOMAS'S PRIMARY SCHOOL,BADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060049UNITY PRIMARY SCHOOL, AJIDOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060050ZUNVE PRIMARY SCHOOL, ZUNVEZUNVEPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060051ANGLICAN PRIMARY SCHOOL 1 IGBOROSUNIGBOROSUNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060052GBENOPO PRIMARY SCHOOL, II, GBENOPOBADAGRY TOWNPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060053LOCAL AUTHORITY PRIMARY SCHOOL, II AJARAAJARA ILUDAPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060057GREEN LIGHT INTERNATIONAL SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060061DIEU- CHAMPIONS NURSERY AND PRIMARYDOKOH-AJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060063YISEYON NURSERY AND PRIMARY SCHOOL1GBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060069HONEYBAY NURSERY AND PRIMARY SCHOOLARAROMI ESEPEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060070VISION LAND NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060071EQUALRIGHT PRIVATE SCHOOLARAROMI ELIJAH BUS. STOPPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060074SHADOW OF ALMIGHTY NURSERY AND PRIMARY SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060076NEW LIFE PRIVATE SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060077CAPTAINFIELD NURSERY AND PRIMARY SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060083SHAROMO ROCK FOUNDATION SCHOOL NURSERY AND PRIMARYAGAIMATHEN, AJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060091MEDALLAND SCHOOLS NURSERY AND PRIMARY SCHOOLAJARA DOKOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060101THE-BLISS ISLAMIC NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060103TOMERALD MONTESSORI SCHOOL NURSERY AND PRIMARYARAROMI ALE, EXTENSION.PRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060105NOGA NURSERY AND PRIMARY SCHOOLOGBLOGBO-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060111FREDSON NURSERY AND PRIMARY SCHOOLIBIYEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060114BLOSSOM PRIVATE SCHOOLAJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060115DE KELMMA NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060116GOD'S WILL ACADEMYARAROMI - ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060125BEULAH NURSERY AND PRIMARY SCHOOLIKOGAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060128MASFUN ACADEMYARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060129GIFTED HERITAGE NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060130ROYALTY INTERNATIONAL SCHOOLARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060131TODEST NURSERY AND PRIMARY SCHOOLOKO-AFO,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060133TOBVIC PRIVATE SCHOOLOKO-AFOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060139A AND D UNIVERSAL SCHOOLIBIYEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060149BECKSON PRITI KIDS SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060150DAMTOPS NURSERY AND PRIMARY SCHOOLMOROGBO-AGBARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060153THE BEST LEGACY NURSERY AND PRIMARY SCHOOLILEDU ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060154MIKEDAVIS NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060162AL- BASHIROH KIDDIES COLLEGEAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060168BEAUTIFUL LONES INTERNATIONAL SCHOOLSPOTAPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060177BLESSED SEAT OF WISDOM NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060179BIS SALAM ISLAMIC NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060181PROGRESSIVE NURSERY AND PRIMARY SCHOOLOWODEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060187SUMRAY NURSERY AND PRIMARY SCHOOLOKO AFO ILOGBO EREMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060189CORNEL HOLY CHILD SCHOOLSBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060197MASET SPRING GROUP OF SCHOOLOKE-IRAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060207HUMBEY NURSERY AND PRIMARY SCHOOLOKO-AFOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060212EDULIGHT PRIVATE SCHOOL AKRAPA IGBOROSUNIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060217PRUDENCE NURSERY AND PRIMARY SCHOOLIBIYEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060224LIGHT OF PEACE NURSERY AND PRIMARY SCHOOLITOGA ZANMU, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060228TOPMAR NURSERY AND PRIMARYSCHOOLOWODE APAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060231ALPHA KINGS SCHOOL BADAGRYBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060233LARION NURSERY AND PRIMARY SCHOOLMOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060245BADAGRY ANGLICAN NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060246BRIGHTER TOMORROW NURSERY AND PRIMARY SCHOOLAJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060249KINGS LIGHT INTERNATIONAL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060252RONNIE GARRIE ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060253COVENANT SCHOLARS ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060258ADCOSY NURSERYAND PRIMARY SCHOOLAPAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060260SUCCESS ACADEMYAGBATHOGBUTHOMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060261THEOTAL NURSERY AND PRIMARY SCHOOLKWEME,BADAGRY WESTPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060262SEMARLIN NURSERY AND PRIMARYAGBOVIPEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060263MARYANN CHOICE PRIVATE SCHOOLZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060265ELASS BRIGHT STAR ACADEMYBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060269PENTECOST INTERNATIONAL SCHOOLOGLOGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060270ARROWHEAD ACADEMYAGBOVIPE JUNCTION, AJARA BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060271CHRIST ANGLICAN MISSION NURSERY AND PRIMARY SCHOOLAJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060274FAITH FOUNDATION NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060275BRILLANT KIDS NURSERY AND -PRIMARY SCHOOLAGONKAMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060275BRILLANT KIDS NURSERY AND -PRIMARY SCHOOLBADAGRY TOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060278OLANS UNIQUE NURSERY AND PRIMARY SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060279MARITA INTERNATIONAL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060280ST. MICHAEL'S INTERNATIONAL NURSERY AND PRIMARYAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060281AMURAPH NURSERY AND PRIMARY SCHOOLSEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060282AL _ SHAFAU NURSERY AND PRIMARY SCHOOLARADAGUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060283LEAD STARS NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060285FRUITFUL-SEED NURSERY AND PRIMARY SCHOOLIRAGONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060289EVIDENCE FOUNDATION NURSERY AND PRIMARY SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060295STRAIGHT PATH PRIVATE SCHOOLARARAPA IGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060296GREAT FAITH ACADEMYIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060298LIVINGSTONE NURSERY AND PRIMARY SCHOOLAKARAPA IGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060302AL - HAYYU NURSERY AND PRIMARY SCHOOL, POTAPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060307UNCLE DALE FOUNDATION SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060312BABS PRIVATE SCHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060315THE CHOSEN FLOCK GROUP OF SCHOOLSSEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060318AL-KITAB CHILDREN'S SCHOOL IYESI-ILOGBOIYESI-ILOGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060321EXCELLENT CHILD ACADEMYIBIYEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060323GODS INTERVENTION NURSERY AND PRIMARY SCHOOLAJARA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060336ROSSYPATH NURSERY AND PRIMARY SCHOOLAJARA BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060338SUNKEM NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060347AMAZING GRACE NURSERY AND PRIMARY SCHOOLILEDU ARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060350DESTINY KIDS NUSERY AND PRIMARY SCHOOLILEDUPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060351BRIGHT DUKE LEARNING FIELDILEDUPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060353BEULAH NURSERY AND PRIMARY SCHOOL OLAJIRE STREET, MOROGBOMOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060356UNCLE LAZ NURSERY AND PRIMARY SCHOOLSEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060358KEHINDE OLAWALE MEMORIAL MISSIONARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060361SANTUARY CRECHE AND ELEMENTRY SCHOOLAPAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060362HOPE NURSERY AND [PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060364MATTNAZA ANGELS NURSERY AND PRIMARY SCHOOLGBAJIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060366ACADA NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060369TOMORROW STAR NURSERY AND PRIMARY SCHOOL, GBOJE AGBOVIPEAGBOVIPEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060370HAGOS GROUP OF SCHOOLSIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060372JUMECS INFANT JESUS NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060375COMAC UPWARD NURSERY AAND PRIMARY SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060376DARUL FALAAH NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATEISLAMIYYAECCE AND PRIMARY
BADAGRY24060377LIFE ACAADEMY NURSERY AND PRIMARYGBETHROMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060380WILSON MEMORIAL NURSERY AND PRIMARY SCHOOLGBEREFUPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060383UNDIVIDED KIDS NURSERY AND PRIMARY SCHOOLGEDU AROKOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060384AL-BARI GROUP OF SCHOOLSBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060387UMAP NURSERY AND PRIMARY SCHOOLGBAJI-YEKEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060388A.G. ISLAMIYYAH SCHOOLOKO-AFO, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060391WESLEY METHODIST NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060396UPHOLDER NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060397GOG'S SOLID TREASURE ACADEMY SCHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060397SOLID FOUNDATIONVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060398FIRST KINGS NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060400GLORAKIN NURSERY AND PRIMARY SCHOOLAGE-MOWO BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060401HOLY INNOCENT NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060403CHILDWORTH INTERNATIONAL SCHOOLARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060415GREAT LEADERS INTERNATIONAL SCHOOLSAKARAPA IGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060422HISTORY MAKERS ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060427HIGHER FOUNDATION SCHOOLERE ROADPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060436TOMIAD NURSERY AND PRIMARY SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060443FRONTLINE GROUP OF SCHOOLSBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060444BEST DELIGHT ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060448RIGHT PATH ACADEMY (AL-MUSTEKEEM SCHOOL)VILLAGEPRIVATEISLAMIYYAECCE AND PRIMARY
BADAGRY24060449DIVINE LOVE NURSERY AND PRIMARY SCHOOLAJARA TOFA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060451SAMJANE ARISE AND SHINE NURSERY AND PRIMARY SCHOOLAGBOVIPEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060455AL USRAH ISLAMIC KIDDIES ACADEMYBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060459UGOLIN DIVINE GRACE NURSERY AND PRIMARY SCHOOLFINAY0NPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060470MAUSEVE NURSERY AND PRIMARY SCHOOLFINAYONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060473EASTER SPRINGS INTERNATIONAL NURSERY AND PRIMARY (JSS) SCHOOLAGE-MOWOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060477DAYSPRING ON HIGH NURSERY AND PRIMARYAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060480BOSAT NURSERY AND PRIMARY SCHOOLARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060486OLAREWAJU MEMORIAL NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060490LUCID PRIVATE SCHOOLIRAGONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060492PROMPTHBELL PRIVATE SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060497EAGLESSTAR NURSERY AND PRIMARYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060499NICE- BEN MORNING STAR NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060523KING STARS INTERNATIONALSCHOOLSVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060525ASCENSION NUSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060527PRIMUS PRIMARY SCHOOLONIREKE-APAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060530GOD LEADS NURSERY AND PRIMARY SCHOOLOKO-AFO,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060532TOTAS PRIVATE NURSERY AND PRIMARY SCHOOLSAVIEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060533DADDY'S HEART NURSERY AND PRIMARY SCHOOLJAVIEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060534JESUYON NURSERY AND PRIMARY SCHOOLEREKITIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060535AYOMI NURSERY AND PRIMARY SCHOOLGBAJIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060538PRECIOUS HOPE ACADEMYOGBLOGBO-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060540ROYAL CALL ACADEMYBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060541C' FORT DESTINY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060543ROBINSON GROUP OF SCHOOL ASHIPA-BADAGRYASHIPAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060545JOSAD HERITAGE INTERNATIONAL SCHOOL PRIMARYPOVITAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060547ICON HALL MONTESSORI NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060548DOMINION NURSERY AND PRIMARY SCHOOLIDALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060551ONO-SHARON NURSERY AND PRIMARY SCHOOLIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060553KING GEORGE MEMORIAL PRIMARY AND NURSERY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060554SOUND MIND INTERNATIONAL SCHOOLMOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060568JOYCE ACADEMYPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060569BRIGHT FUTURE ACADEMYSEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060571FATMUN NURSERY AND PRIMARY SCHOOLSEME-AKETEGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060572SEDIS NURSERY AND PRIMARY SCHOOLAJARA - VETHOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060581MERITLAND NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060582METHODIST NURSERY AND PRIMARY SCHOOLFARASIME-BADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060585MASIM NURSERY AND PRIMARY SHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060587REDEEMERS INTERNATIONAL SCHOOL BADAGRY AXISARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060588DIVINE SUCCESS PRIVATE SCHOOLATINPOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060592GODS FAVOUR NURSERY PRIMARY AND SECONDARY SCHOOLOGBLOGBO-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060595NOCH SCHOOL NURSEY AND PRIMARY SCHOOL ( NOBLE)ATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060599LAMPSTAND NURSERY PRIMARY AND BASIC SCHOOLILEDUPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060605WACON INTERNATIONAL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060609PINNACLE NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060611TRANSFORMATION ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060623GOLDEN LIGHT FOUNDATION SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060626PERKY HILLS SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060627GOLDEN CROWN NURSERY AND PRIMARY SCHOOLARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060629REDEEM CHILDREN SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060630ZENITH NURSERY AND PRIMARY SCHOOLIBIYEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060631GLAMOROUS CHILDREN SCHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060636VALDAMA PRIVATE SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060771CRM AMAZING GRACEIDALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060775KNOWLEDGE COURT NURSERY/PRIMARY SCHOOLMTN BUS STOP OKUNNU, ARAROMI-ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060777GOODLUCK INTERNATIONAL SCHOOLGANJO BEACH-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060781CHIJAY KINGDOM KIDS NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060782BLESSED CHILDREN NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060783FRILLYJAY REDEMPTION NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060784UNITY INTERNATIONAL NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060788JAMESON MODEL COLLEGEIKAGO ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060789JOSSY - ANNE NURSERY AND PRIMARY SCHOOLBADAGRY TOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060794AMAZING KIDDIES NURSERY AND PRIMARY SCHOOLGBAJIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060796SIMTOP NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060797ABFEM INTERNATIONAL SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060802KENPAT NURSERY AND PRIMARY SCHOOLAJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060805HAPPY GLORIA NURSERY AND PRIMARY SCHOOLAGE-MOWO BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060807LEAD STARS GROUP OF SCHOOLSVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060808JIJOHO NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060811JAKEY GLORYLAND CHILDREN SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060816FORTRESS KIDDIES ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060817DIVINE REDEEMER NURSERY AND PRIMARY SCHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060826MARYGOLD NURSERY AND PRIMARY SCHOOL SEMEBABA PUPA-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060827KINGDOM HERITAGE MODEL SCHOOLBADAGRY TOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060829TOLLY EXCEL PRIVATE SCHOOLOKOAFOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060832GLORY GATE NURSERY AND PRIMARY SCHOOLILEDU ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060834EVER-FLOURISH INTERNATIONAL SCHOOLIRAGONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060835JUBETH NURSERY AND PRIMARY SCHOOLZINVIE, AJARA BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060850NURU- AWULAD NURSERY AND PRIMARY SCHOOLZANGO-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060867FRENCH VILLAGE INTERNATIONAL STAFF SCHOOLBADAGRYPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060869EXCELLENT SIMMY NURSERY AND PRIMARY SCHOOLMOWOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060870LEADING LIGHT NURSERY AND PRIMARY SCHOOLMOWO BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060873ALL AROUND POSITIVE NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060874JOHTECH NURSERY AND PRIMARY SCHOOLAGE-MOWOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060877SEDAM NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060879HOLY CHILDREN ACADEMY NURSERY AND PRIMARYAJARA VETHOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060880KESNA NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060882DIAMOND NURSERY AND PRIMARY SCHOOL.BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060883AI. ROYAL NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060884KAFO YAHWEY NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060886HOME ECONOMICS CENTREBADAGRYPUBLICCONVENTIONALPRIMARY ONLY
BADAGRY24060887MINI RESOURCE CENTRE,LGEABADAGRYPUBLICCONVENTIONALPRIMARY ONLY
BADAGRY24060888ARTS & CRAFTS CENTREBADAGRYPUBLICCONVENTIONALPRIMARY ONLY
BADAGRY24060889JOEL DIVINE PEACE NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060890UNFOLDING POTENTIAL MONTESSORI NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060891BLUEPRINT NURSERY AND PRIMARY SCHOOLFINAYONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060893ASCON STAFF PRIMARY SCHOOLTOPO,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060894TCUBE NURSERY & PRIMARY SCHOLLTOPO,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060895MODEM NURSERY& PRIMARY SCHOOLTOP0,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060899FOMWAN NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060900THE PEACE ACADEMY NURSERY AND PRIMARY SCHOOLNEW BADAGRYPRIVATEISLAMIYYAECCE AND PRIMARY
BADAGRY24060902ST MOSES GLORIOUS NURSERY AND PRIMARY SCHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060903LEADFIELD ACADEMYIRAGONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060904RIGHT PLACE NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060905ACHIEVERS MODEL SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060906WHENSTR PRIVATE SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060907CHRISTALIVE ACADEMYAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060908DANVICK PRIVATE SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060909SOUTHRISE MODEL SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060910CONFIDENCE NURSERY AND PRIMARY SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060911LEADING BRAIN NURSERY AND PRIMARY SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060912BENJOY PRIVATE SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060913NEW STAR ACADEMYAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060914OKIKI-AYO NURSERY AND PRIMARY SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060915OVERFLOWING MONTESSORI SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060916PRIME-TINE PRIVATE SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060917STARDOM IMPERIAL SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060918SEAT OF WISEDOM ACADEMYIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060919SAMVIC NURSERY AND PRIMARY SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060920KENJAY PRIVATE SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060922MULTIPLE HEIGHTS NURSERY AND PRIMARY SCHOOL ARADAGUNVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060923AS-SAKEENAH NURSERY AND PRIMARY SCHOOL, ARADAGUNVILLAGEPRIVATEISLAMIYYAECCE AND PRIMARY
BADAGRY24060924AJANIKE NURSERY AND RIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060925FULEADS NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060927KEMMYSAM NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060928EDUCATION LEADS TO GREATNESS MODEL NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060929QUEEN ESTHER ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060930ST. CHARLES CITADEL NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060931SURE RADIANCE NURSIRY AND RIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060932ACHIEVERS COVE SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060933HOE FOR LIFE SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060934NEW LIGHT NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060935ROCKTOP CLASSIC PRIVATE SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060936KEFAS NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060937GLORYLINE MODEL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060938PATSONDI INTERNATIONAL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060939MIFACOM SEED NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060940IMMACULATE SAM NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060941LOCAL AUTHORITY PRIMARY SCHOOL OKOGBO-MOBAOKOGBO-MOBAPUBLICCONVENTIONALECCE AND PRIMARY
BADAGRY24060942GOODNESS AND DAVID AMBASSADORSILE-EPO ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060944JOSEDAP PRIVATE SCHOOLILOGBO EREMI OKO-AFOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060945ST. SIMON GROUP OF SCHOOLSARAROMI-ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060946HIS HERITAGE PRIVATE NURSERY AND PRIMARY SCHOOLARAROMI-ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060948FERALAND NURSERY AND PRIMARY SCHOOLARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060950DAMVIC NURSERY AND PRIMARY SCHOOLARAROMI - ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060952HOPEY GLAD NURSERY AND PRIMARY.MOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060953GREENPARK PRIVATE SCHOOLMOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060954CHARIKLEM NURSERY AND PRIMARY SCHOOLMOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060955DAVIS NURSERY AND PRIMARY SCHOOLMOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060957BLOSSOM CHILDREN FOUNDATIONOKE IBUJEUN-MOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060958CHRIST THE SUPREME NURSERY AND PRIMARY SCHOOLMOROG BOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060960DENEB NURSERY SCHOOLELERUN ESTATE ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060961CHERYL NURSERY AND PRIMARY SCHOOLGBAJI-YEKETOMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060961HERITAGE PRIVATE SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060962BRILLIANT ACADEMYATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060962TOLU G GRACE NURSERY AND PRIMARY SCHOOL, APAAPAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060963GOD'S PERFECT WILL PRIVATE SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060963SHINEFORTH INTER. SCHOOL KANKONKANKONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060964GOLDEN KIDS NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060965FUTURE LEADERS INTERNALTIONAL SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060965LORDS NEW GENERATION SCHOOLSEME BORDERPRIVATECONVENTIONALPRIMARY ONLY
BADAGRY24060966ATOP BARIN BASE ACADEMY (ABBA)MOWO ATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060966BELIEVERS DOMINION SCHOOLSEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060967GRRENFIELD PRIVATE SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060967WONDERFUL PRIVATE SCHOOL, SEME BORDERSEME BORDERPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060968AT-TOYYIB HALL NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060968BRAINY INTERNATIONAL COLLEGE, SEME BORDERSEME BORDERPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060969BETTER LIFE SCHOOLAGBADAGBOTHOMEH, SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060969THE WILL OF GOD NURSERY AND PRIMARY SCHOOLIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060970SOUND FOUNDATION PRIMARY SCHOOLSEME-BORDERPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060970VINCORD SCHOOLSIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060971DIGITAL SCIENCE NURSEYR AND PRIMARY SCHOOLIKOGA-ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060971MARVELOUS PRIMARY SCHOOLCAPINTA-SEMEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060972ELOVILE NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060972GODS FAVOUR PRIMARY SCHOOL APAAPAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060973SUCCESS PATHWAY ACADEMYPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060974STEP FORTE SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060975BISTARON MONTESSORI SCHOOLALAFIA, IBEREKOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060975BRILLIANT EFFORT INTERNATIONAL SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060976GREAT PHICEC NURSERY AND PRIMARY SCHOOLVETHO, AJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060976ST. MONIQUE NURSERY AND PRMARY SCHOOLIRAGONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060977EMART NURSERY AND PRIMARY SCHOOLZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060977KINGS AND QUEENS FAVOUR SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060978GEPS PRIVATE SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060979NIKKYBEE INTERNATIONAL SCHOOLIRAGON/AGBADOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060980MIRACLE NURSERY AND PRIMARY SCHOOLIKAGO ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060981FREEDOM SCHOOLSATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060982CHOSEN DESTINY INTERNATIONAL NURSERY AND PRIMARY SCHOOLIRANGONPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060983YINNA NURSERY AND PRIMARY SCHOOLITE-IKOGAPRIVATEISLAMIYYAECCE AND PRIMARY
BADAGRY24060984FOPHAS NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060985GOLD'S HEIGHT ACADEMYPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060986ROSEMARK NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060987FERTILE BRAIN SCHOOLSIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060988VIAJAS MONTESSORI SCHOOLIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060989GLORY LANDER'S SCHOOLIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060991HOSANNA COMPREHENSIVE NURSERY AND PRIMARY SCHOOLAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060994MODESTY NURSERY AND PRIMARY SCHOOLIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060995AGLOW NURSERY AND PRIMARY SCHOOLIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060996FIRST CHANNEL MONTESSORI SCHOOLPOTAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060997GLORIOUS FOUNDATION ACADEMYIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060998WISEBRAIN INTERNATIONAL SCHOOLS (MONTESSORI)JAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24060999PEPPS GRACE ACADEMYIKOGA ZEBBEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061000MYSTERY INTERNATIONAL KIDDIES SCHOOLJAVIEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061001VICTORY BETTERDAY NURSEY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061003INTELLECTUAL ACADEMYAVIAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061004BENJOSA NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061008FRANKDALE SCHOOLATINPOROMEHPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061011FUNDAMENTAL CHILDREN ACADEMY NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061012SOPHENS NURSERY AND PRIMARY SCHOOLBADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061013ALBERT UPWARD MONTESSORI NURSERY AND PRIMARY SCHOOLOWOLOWO,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061014DELIGHT NURSERY AND PRIMARY SCHOOLOWOLOWO,BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061015PRECIOUS GIFT INT'L NURSERY AND PRIMARY SCHOOLOKO-AFOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061019SAINT AMBRASS NURSERY AND PRIMARY SCHOOLIBEREKOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061030UTMOST HOPE PRIVATE ACADEMYARAROMI- ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061031GREAT PHICEC NURSERY AND PRIMARYAJARA VETHOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061037OYES NURSERY AND PRIMARY SCHOOLAJARO, TOPAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061038JIDENSON NURSERY AND PRIMARY SCHOOLAJARA, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061039GOD'S PLAN ACDEMYAJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061040HEROS PATH NURSERY AND PRIMARYIBEREKOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061041CHRIM THOG STARS NURSERY AND PRIMARY SCHOOLIBEREKO, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061043AL-MUBARAK ACADEMYAJIDO, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061044PACEBEARER ACADEMYIBEREKOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061045EMIRATE VILLE NURSERY AND PRIMARYTOPO/IDALE, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061046RIDOHLLAHI AKBAR INTERNATIONAL SCHOOLILOGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061050ST. FRANCIS INTERNATIONAL NURSERY AND PRIMARY SCHOOLTOHON - TOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061051GOLDEN HERITAGE ACADEMYTOHON BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061051GREATER SOLOMON MOVERMENT ACADEMYVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061052FRANCIS XAVIER SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061053GOD'S GRACE GROUP OF SCHOOLSVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061054EASEBELL GROUP OF SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061055GRACE HOUSE NURSERY AND PRIMARYSCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061056AMAZING EAGLES SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061057MAYRATON NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061058ARK OF FAITH MODEL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061059GOD'S POWER NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061060UNI-SAM ACADEMY NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061061DEVINE VOICE NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061062AFRICAN BETHEL NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061063ACODEX NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061064JOSADS HERITAGE INTERNATIONAL SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061065MICAB MONTESSORI NURSERY AND RIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061067KIDSTOWN NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061068TREASURE TREND SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061069HAYLAND NURSERY AND PRIMARY SCHOOLVILLAGEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061071LUCKY CHILDREN NURSERY AND PRIMARY SCHOOLILEDUPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061072P-SQUARE DIVINE SCHOOLILEDU ARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061073GREAT GIFT SCHOOLILEDU ARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061074CONGRAT NURSERY/PRIMARY SCHOOLILEDU ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061075FIRST CLASS SCHOOL NURSERY AND PRIMARYILEDU ARAROMI ALEPRIVATENOMADICECCE AND PRIMARY
BADAGRY24061076BESMAT NURSERY AND PRIMARYILEDU ARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061079DE-PRIDE NURSERY AND PRIMARY SCHOOL.ILEDU ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061085CHRIST THE REDEEMER'S RECOVERY SCHOOLOKE-IBUJEUN, MOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061086LIVING STREAM NURSERY AND PRIMARY SCHOOLOKE IBUJEUN MOROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061088YAWS MONTESSORIIBIYEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061091SUCCESS FOUNDATION ACADEMYAJARA TOWN, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061092AD-DIRAYAT NURSERY AND PRIMARY SCHOOLIBEREKO, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061093AROVIT MEMORIAL SCHOOLAJARAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061094ZULBASS ACADEMY NURSERY AND PRIMARYILEFUNFUN ALADEOGUN TOWNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061095DARUS - SALAM LI-BIN ZUBAIRILE-FUNFUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061096AL-IS'IAD INTERNATIONAL SCHOOLOKE - IRAPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061097QUTBZAMANY NURSERY AND PRIMARYIDI - OROGBOPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061098MUHAMMAD AL-HADI MEMORIAL NURSERY AND PRIMARYIBEREKI, BADAGRYPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061100UNIQUE MIGHTY CHILDREN NURSERY/PRIMARY SCHOOLELIJAH BUS STOP PHASE 2 ARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061101GLAMOUR KINGS $ QUEEN SCHOOL.ARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061102AUSTER NURSERY AND PRIMARY SCHOOLIGBOROSUNPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061103BLESSED FOUNDATION PRIVATE SCHOOLARAROMI ALEPRIVATECONVENTIONALECCE AND PRIMARY
BADAGRY24061147AL-IMAM NURSERY AND PRIMARY SCHOOLAJARAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070001ANGLICAN PRIMARY SCHOOL, EBUTE-AFUYEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070002ANGLICAN PRIMARY SCHOOL, AJEBOAJEBOPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070003ANGLICAN PRIMARY SCHOOL, SALASALAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070004ANGLICAN PRIMARY SCHOOL, SEKUNGBASEKUNGBAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070005ANSAR-UD-DEEN. PRIMARY SCHOOL, EPEALAWAYE EPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070006ANSAR-UD-DEEN. PRIMARY SCHOOL IBONWON,IBONWONPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070007ANSARUL DEEN PRIMARY SCHOOL, ODO EGIRIODO-EGIRI, EPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070008ARMY BARRACKS PRIMARY SCHOOL, OKE-OYINBO, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070009ARMY CHILDREN PRIMARY SCHOOL, OKE-OYINBO, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070010BAPTIST DAY PRIMARY SCHOOL, AGBOWAAGBOWA-IKOSIPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070011CHRIST CHURCH PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070012COMMUNITY PRIMARY SCHOOL, EREPOTO IIEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070014GOVERNMENT DEMONSTRATION PRIMARY SCHOOL, LACOPED, NOFORIJANOFORIJAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070015LOCAL GOVERNMENT CENTRAL PRIMARY SCHOOL, AGBOWA IKOSIAGBOWA-IKOSIPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070016LOCAL GOVERNMENT CENTRAL PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070017LOCAL GOVERNMENT PRIMARY SCHOOL, NOFORIJAEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070018LOCAL GOVERNMENT PRIMARY SCHOOL, OBADA VILLAGEOBADAPUBLICNOMADICPRIMARY ONLY
EPE24070019LOCAL GOVERNMENT PRIMARY SCHOOL, OGUNTEDOOGUNTEDOPUBLICCONVENTIONALPRIMARY ONLY
EPE24070021LOCAL GOVERNMENT PRIMARY SCHOOL, ABOMITIABOMITIPUBLICMIGRANT FISHERMEN/ FARMERSPRIMARY ONLY
EPE24070022LOCAL GOVERNMENT PRIMARY SCHOOL, ABOREJIABOREJIPUBLICNOMADICPRIMARY ONLY
EPE24070023LOCAL GOVERNMENT PRIMARY SCHOOL, AGBOWA IKOSI, ADO VILLAGEIKOSIPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070024LOCAL GOVERNMENT PRIMARY SCHOOL, EMINA RIVERINEEMINAPUBLICNOMADICECCE AND PRIMARY
EPE24070025LOCAL GOVERNMENT PRIMARY SCHOOL, IBON EPEIBONPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070026LOCAL GOVERNMENT PRIMARY SCHOOL, IGBOGUN VILLAGEIGBOGUNPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070027LOCAL GOVERNMENT PRIMARY SCHOOL, IGBOOYEIGBOOYEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070028LOCAL GOVERNMENT PRIMARY SCHOOL, IMEKI-OKE, VIA ILAMIJAIMEKI-OKEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070029LOCAL GOVERNMENT PRIMARY SCHOOL, IMOSAN, OKUN-IMOSANIMOSANPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070030LOCAL GOVERNMENT PRIMARY SCHOOL, IPESU, EPEIPESUPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070031LOCAL GOVERNMENT PRIMARY SCHOOL, ISE, VILLAGEISEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070032LOCAL GOVERNMENT PRIMARY SCHOOL, ITO-OMU EPEITO-OMUPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070033LOCAL GOVERNMENT PRIMARY SCHOOL, LADABA VILLAGELADABAPUBLICCONVENTIONALPRIMARY ONLY
EPE24070034LOCAL GOVERNMENT PRIMARY SCHOOL, LUBOYE VILLAGEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070035LOCAL GOVERNMENT PRIMARY SCHOOL, MAYUNRE VILLAGEMAYUNREPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070036LOCAL GOVERNMENT PRIMARY SCHOOL, MOYOPA VILLAGEMOYOPAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070037LOCAL GOVERNMENT PRIMARY SCHOOL, OKORISANOKORISANPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070038LOCAL GOVERNMENT PRIMARY SCHOOL, OREPETEOREPETEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070039LOCAL GOVERNMENT PRIMARY SCHOOL, ORIBAORIBAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070040LOCAL GOVERNMENT PRIMARY SCHOOL, OTTA-IKOSIOTTA-IKOSIPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070041LOCAL GOVERNMENT PRIMARY SCHOOL, YEGUNDAYEGUNDAPUBLICCONVENTIONALPRIMARY ONLY
EPE24070042LOCAL GOVERNMENT PRIMARY SCHOOL, ISANISANPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070043LUPETORO PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070044LUYEPO PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070045METHODIST PRIMARY SCHOOL AGBOWA-IKOSIAGBOWAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070046POBO PRIMARY SCHOOL, POKAPOKAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070047R.C.M PRIMARY SCHOOL, IGBODUIGBODUPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070048R.C.M PRIMARY SCHOOL, KETU, EKETU-EPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070049R.C.M PRIMARY SCHOOL, ITOIKINITOIKINPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070050R.C.M PRIMARY SCHOOL, MOJODAMOJODAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070051ROMAN CATHOLIC MISSION PRIMARY SCHOOL, OKE, EJINRINEJINRINPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070052SOLOMON MEMORIAL PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070053ST. ANGNES R. C. M. PRIMARY SCHOOL, ORUGBOORUGBOPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070054ST. MICHEAL ANGLICAN PRIMARY SCHOOL II, POPO OBA LAGBADEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070055ST. PETER'S ROMAN CATHOLIC MISSION PRIMARY SCHOOL, EREDOODORAGUNSHIN, EPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070056ST. JAMES ANGLICAN PRIMARY SCHOOL, MUSEJU/MUTAKUNMUSEJU/MUTAKUNPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070057ST. JOHN R.C.M PRIMARY SCHOOL ODOMOLA, EPE-IJEBUODMOLA, EPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070058ST. JOHN'S ANGLICAN PRIMARY SCHOOL, OKE-OSO, OKE-OSO VILLAGEOKE-OSOPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070059ST. JOSEPH'S R.C.M. PRIMARY SCHOOL IBONWON IBINBONWONPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070060ST. JOSEPH'S R.C.M. PRIMARY SCHOOL, IMOPEIMOPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070061ST. MICHEAL'S ANGLICAN PRIMARY SCHOOL, POPO-OBA EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070062ST. PAUL'S ANGLICAN PRIMARY SCHOOL, IGBOOYEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070063ST. STEPHEN'S R.C.M. PRIMARY SCHOOL, IGBONLAIGBONLAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070064ST. THERESA'S R.C.M PRIMARY SCHOOL, OKE OYINBOEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070065ST. VINCENT'S R.C.M. PRIMARY SCHOOL, IJI EPEIJIHPUBLICCONVENTIONALPRIMARY ONLY
EPE24070066U. P. E PRIMARY SCHOOL, IGBODU, IGBODU RIVERINEIGBODUPUBLICNOMADICPRIMARY ONLY
EPE24070067U. P. E PRIMARY SCHOOL, IRAYE-OKEIRAYE-OKEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070068U. P. E PRIMARY SCHOOL, AKODO-ISEAKODO ISE TOWNPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070069U. P. E. PRIMARY SCHOOL, AJENGBEDE VILLAGEAJEGBENDEPUBLICNOMADICECCE AND PRIMARY
EPE24070070U. P. E. PRIMARY SCHOOL, IGANKE,IGANKEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070071U. P. E. PRIMARY SCHOOL, IKERAN,IKERANPUBLICMIGRANT FISHERMEN/ FARMERSPRIMARY ONLY
EPE24070072U. P. E. PRIMARY SCHOOL, IMOKUNIMOKUNPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070073U. P. E. PRIMARY SCHOOL, ODO-AYANDELUODO-AYANDELUPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070074U. P. E. PRIMARY SCHOOL, ODOGBAWOJOODOGBAWOJOPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070075UNIVERSAL PRIMARY SCHOOL, ILARAILARAPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070076ZUMRATUL ISLAMIMIYYAT PRIMARY SCHOOL II, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070077ZUMRATUL ISLAMIYYAH PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070081B-DIVINE CRECHE NURSERY AND PRIMAEY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070082BARIDOO STANDARD PRIVATE SCHOOLPAPA EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070084ISGRACE NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070085LIFE LINE CHILDREN SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070091GOD GRACE NURSERY & PRIMARY SCHOOL IRAYEIRAYE-OKEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070094KODER DIVINE NURSERY AND PRIMARY SCHOOLPOKA - EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070101SHARAN VINEYARD PRIMARY SCHOOLODOMOLAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070102BOOMING GLORY INTERNATIONAL SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070103THE UMMAH MODEL SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070108BAPTIST NURSERY AND PRIMARY SCHOOLPAPA EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070109GOD'S GLORY NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070110BRIGHT STAR CHILDRENS SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070112MINARET PRIVATE NURSERY AND PRIMARY SCHOOLODOMOLAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070113FESMUDIA FOUNDATION NURSERY & PRIMARY SCHOOLIRAYE-OKEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070114CHRISTLAND NURSERY&PRIMARY SCHOOLPAPA-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070117GOD'S TIME NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070126CHITTED NURSERY & PRIMARY SCHOOLITOIKINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070128BROTHERHOOD IN GOOD FAITHEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070130NAJMOT NURSERY AND PRIMARY SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070133WONUOLA NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070134TRUST FAITH FOUNDATION NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070139DE-TOPE OLU NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070142EHI VICTORY NURSERY AND PRIMARY SCHOOLPAPA-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070143GREAT JUBILANT NURSERY & PRIMARY SCHOOLAGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070144DE-MORNING STAR NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070148NEW HIOPE NURSERY PRIMARY SCHOOLTEMU-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070154LAUREATE NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070156GOD'S LIGHT NURSERY & PRIMARY SCHOOLAGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070157HIS LIGHT NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070160GIMBAK NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070165B&T MEMORIAL NURSERY AND PRIMARY SCHOOLODOMOLAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070166DE-IDEAL NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070167AUNTY NIKKY NURSERY AND PRIMARY SCHOOLKETU-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070169OLAYEMI NURSERY AND PRIMARY SCHOOLOTTA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070170JOLAYEMI NURSERY AND PRIMARY SCHOOLURAKA EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070171THE LORD HOLINESS PRIVATE SCHOOLODO-AJOGUN MOJODA-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070172LIZABETH NURSERY & PRIMARY SCHOOLEREPOTO-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070174HOPE CILDREN NURSERY AND PRIMARY SCHOOLOTTA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070177SEGTOL PRIVATE SCHOOLOWU AGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070178GOD'S EYE NURSERY AND PRIMARY SCHOOLPOKA EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070183DE LIGHT INTERNATIONAL NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070184RHEMA INTERNATIONAL ACADEMYEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070187AB NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070190BETHEL ELOHA NURSERY & PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070191ROYALBREED ACADEMY CRECHE NUR & PRY SCHOOL, PAPA-EPEPAPA-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070192OYINFEMI INTERNATIONAL SCHOOLODOMOLAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070198MARVELOUS NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070199TUNNS TUNNEL NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070201CHRIST DE-JOY NURSERY AND PRIMARY SCHOOLODOMOLAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070205COLE NURSERY AND PRIMARY SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070206MERIT ELEMENTARRY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070208MERCY LAND NURSERY AND PRIMARY SCHOOLIRAYE-OKEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070209NIKFAD NURSERY & PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070211OMOBORIOWO KID NURSERY AND PRIMARY SCHOOLIBONWONPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070212DEBASCO NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070215CITY GATE NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070216ABC NURSERY AND PRIMARY SCHOOLAGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070218TURISININA PRIVATE SCHOOLIRAYE-OKE, EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070219THEE GREATEST INTERNATIONAL SCHOOL IRAYEIRAYE-OKEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070221EBUN AYO NURSERY AND PRIMARY SCHOOLOLOJA ESTATE EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070222TRICHVILLE NURSERY AND PRIMARY SCHOOLITOIKINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070229SEAT OF WISDOM NURSERY AND PRIMARY SCHOOLKETUPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070234AMBASSADOR NURSERY AND PRIMARY SCHOOL IRAYEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070235DIVINE LIGHT NURSERY & PRIMARY SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070236KOMOLAFE NURSERY AND PRIMARYSCHOOLITOIKINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070237STRAIGHT GATE SUCCESS NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070240GOD HERISTAGE NURSERY AND PRIMARY SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070244CLARITY TEES SCHOOLODOMOLAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070246EL-BOSSAA NURSERY AND PRIMARY SCHOOLPAPA EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070247THE PEES NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070248FOUNTAIN CHILDREN ACADEMYEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070251BEST LEGACY INTERNATIONAL ACADEMICEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070253EUCHARISTIC HEAT OF JESUS NURSERY AND PRIMARY SCHOOLIBONWONPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070254GOD FIRST NURSERY AND PRIMARY SCHOOLIBONWON, EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070258GOD'S FOUNDATION CHILDREN SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070259FOUNDATION KIDS INTERNATIONAL SCHOOLADO, AGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070264AL-ITQAN NURSERY AND PRIMARY SCHOOLEPEPRIVATEISLAMIYYAECCE AND PRIMARY
EPE24070266BODMAS NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070271ONWARD NURSERY & PRIMARY SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070272MOCPED INTERNATIONAL NURSERY AND PRIMARY SCHOOLNOFORIJAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070273DYNAMIC KIDDIES COLLEGEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070274HOUSE OF JOY NURSERY AND PRIMARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070277SUPER ALARO MURSERY AND PRIMARY SCHOOLAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070280EPE LOCAL GOVERNMENT NURSERY AND PRIMARY SCHOOLEPEPUBLICCONVENTIONALECCE AND PRIMARY
EPE24070286CECILVILLE NURSERY AND PRIMARY SCHOOLODO-AYANDELUPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070287DE-EXCEL NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070287EXCEL NURSERY AND PRIMARY SCHOOLODORAGUNSHINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070294ISKANUL L HAQ FOUNDATION EDUCATIONAL EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070295TOPAZ/KARIS NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070323ART & CRAFT CENTRE AT LOCAL GOVT. PRIMARY SCHOOL, COMPOUND, EPEEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070325HOME ECONOMICS CENTRE, METHODIST PRIMARY SCHOOL COMPOUND, AGBOWA-IKOSIAGBOWA-IKOSIPUBLICCONVENTIONALPRIMARY ONLY
EPE24070328HOME ECONOMICS CENTRE AT ST. THERESA'S PRIMARY SCHOOL COMPOUNDTOWNPUBLICCONVENTIONALPRIMARY ONLY
EPE24070330COMPUTER CENTRE C/O LOCAL GOVT. CENTRAL PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070331COMPUTER CENTRE, ST. THERESA'S PRIMARY SCHOOL COMPOUNDEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070332MINI RESOURCE CENTRE, LGEA, EPEEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070333BLESSED CHILDREN SCHOOL, ADO-IKOSIAGBOWAPRIVATECONVENTIONALECCE ONLY
EPE24070334DE-GLADET RHESA SCHOOL, AGBOWAAGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070336AL-MAAJID INTERNATIONAL SCHOOL,AGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE240703395/6 NURSERY & PRIMARY SCHOOL, AGBOWA-IKOSIAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070340DE VICTORY PRIVATE SCHOOL, AGBOWA IKOSIAGBOWA IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070342REDEEMER'S NURSERY AND PRIMARY SCHOOL, OKO-ABEOKO-ABEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070343TEE-DEE HERITAGE SCHOOL, AGBELE, OTTA-IKOSIOTTA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070348JOPREN ROYAL INTERNATIONAL SCHOOLODO-AYANDELU EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070349STELLTO FOUNTAIN NURSERY AND PRIMARY SCHOOL, ITOIKINITOIKINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070350LIFE LINE CHILDREN SCHOOL, ITOIKINITOIKINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070352BRIGHTER FUTURE NURSERY AND PRIMARY SCHOOL, KETUKETUPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070353GOLDEN STAR NURSERY AND PRIMARY SCHOOL, EJINRINEJINRINPRIVATECONVENTIONALECCE ONLY
EPE24070354PRECIOUS FORTUNE NURSERY AND PRIMARY SCHOOL, ITOIKINITOIKINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070355RISING STARS ACADEMY, EJINRINEJINRINPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070356ST. MARY NURSERY & PRIMARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070357OLA'S MEMORIAL NURSERY AND PRIMARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070358FORTUNE KIDS FOUNDATION AND PRIMARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070359FLOURISH STAR ACADEMY, EREPOTO-EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070360CHALCEDONY ELEMENTARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070363MARBLE FIELD NURSERY AND PRIMARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070364DARU-L-KHAIRI NUESERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070365FREELAND MONTESSORI INTERNATIONAL SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070366ASH TEMY NURSERY AND PRIMARY SCHOOL, EPEEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070367TESMOH INTERNATIONAL NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070368HOME ECONOMICS CENTRE Z.I. PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070369ART AND CRAFT CENTRE LUYEPO PRIMARY SCHOOL, EPEEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070371HOME ECONOMICS CENTRE POBO COMMUNITY PRIMARY SCHOOL, POKAEPEPUBLICCONVENTIONALPRIMARY ONLY
EPE24070373HOME ECONOMICS CENTRE RCM PRIMARY SCHOOL, IBONWONIBONWONPUBLICCONVENTIONALPRIMARY ONLY
EPE24070377EDDY'S STANDARD PRIVATE SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070379VIVID MIND NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070381HIS PECULIAR TREASURE MODEL SCHOOLSEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070385TEMREW NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070386DE-REAL NURSERY AND PRIMARY SCHOOLEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070387ATLANTIC CRESCENT SCHOOL, EPECELE-IRAYEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070389SAINT BENEDICT'S JUNIOR ACADEMYEPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070390ROYAL PRIESTHOOD NURSERY AND BASIC SCHOOL, AGBOWAAGBOWA-IKOSIPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070392LOVE FOUNDATION SCHOOL, AGBOWA-IKOSIAGBOWAPRIVATECONVENTIONALECCE AND PRIMARY
EPE24070394JOECHRIS NURSERY AND PRIMARY SCHOOL, TEMU-EPETEMU-EPEPRIVATECONVENTIONALECCE AND PRIMARY
EPE24071914COMMUNITY PTIMARY SCHOOL I, EREPOTO-EPEEPEPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080001ADO PRIMARY SCHHOL, ADOADDOPUBLICNOMADICECCE AND PRIMARY
ETI-OSA24080002AJIRAN PRIMARY SCHOOL, AJIRANAJIRANPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080003AKINLADE PRIMARY SCHOOL, OKUN-MOPUOKUN-MOPUPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080004ANSAR-UD-DEEN PRIMARY SCHOOL, ETI-OSAVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080005ARCH BISHOP TAYLOR MEMORIAL PRIMARY SCHOOL, ETI-OSAVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080006ARMY CHILDREN PRIMARY SCHOOL, ETI-OSAVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080007ARMY CHILDREN PRIMARY SCHOOL, DODAN BARRACKS IKOYIIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080008AWOYAYA PRIMARY SCHOOL, AWOYAYAVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080009BADORE PRIMARY SCHOOL, BADOREBADOREPUBLICNOMADICECCE AND PRIMARY
ETI-OSA24080010BONNY CAMP. PRIMARY SCHOOL, ETI-OSAVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080011DODAN BARRACKS PRIMARY SCHOOL, OBALENDEIKOYI - OBALANDEPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080012EPIPHANY ANGLICAN PRIMARY SCHOOL, ABAGBOTARKWA BAYPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080013FEDERAL HOUSING ESTATE PRIMARY SCHOOL, ETI-OSAVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080014IKOYI GIRLS MODERN ACADEMY IKOYIIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080015HOPE PRIMARY SCHOOL, IKOYIIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080016IKOTA PRIMARY SCHOOL, IKOTAIKOTAPUBLICNOMADICECCE AND PRIMARY
ETI-OSA24080017IKOYI PRIMARY SCHOOL, IKOYIIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080018ILASAN PRIMARY SCHOOL, ILESANILASANPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080019IRETI GIRLS PRIMARY SCHOOL, IRETITOWNPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080020IRETI PRIMARY SCHOOL, IRETIIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080021ITEDO COMMUNITY PRIMARY SCHOOL, ITEDOITEDOPUBLICCONVENTIONALPRIMARY ONLY
ETI-OSA24080022JAMA-ATUL ISLAMIYYA PRIMARY SCHOOL, ETI-OSATOWNPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080023JINADU ANGLICAN PRIMARY SCHOOL, JINADUIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080024KURAMO PRIMARY SCHOOL, KURAMOVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080025LANGBASA PRIMARY SCHOOL, LANGBASALANGBASAPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080026LAGOS STATE MODEL NURSEY AND PRIMARY SCHOOL, ETI-OSAETI OSAPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080027MAIYEGUN COMMUNITY PRIMARY SCHOOL, MAIYEGUNMAIYEGUNPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080028OBALENDE PRIMARY SCHOOL, OBALENDEIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080029OGBOMBO COMMUNITYUNITY PRIMARY SCHOOL, OGBOMBOOGBOMBOPUBLICNOMADICECCE AND PRIMARY
ETI-OSA24080030OKUN AJAH PRIMARY SCHOOL, OKUN AJAHOKUN AJAHPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080031OLOMU PRIMARY SCHOOL, OLOMUAJAHPUBLICNOMADICECCE AND PRIMARY
ETI-OSA24080032SANGOTEDO PRIMARY SCHOOL, SANGOTEDOSANGOTEDOPUBLICNOMADICECCE AND PRIMARY
ETI-OSA24080033ST. GEORGES BOYS PRIMARY SCHOOL, ETI-OSAIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080034ST. GEORGES GIRLS PRIMARY SCHOOL, ETI-OSAIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080035VICTORIA ISLAND PRIMARY SCHOOL, VICTORIA ISLANDVICTORIA ISLANDPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080038ADE-AGBA CRES'SET SCHOOLBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080040AGC SAVIOUR NURSERY AND PRIMARY SCHOOLIKOYI OBALANDEPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080046ALDAMAK NOURAN PRIMARY SCHOOLLANGBASAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080065ATTWOOL SUNFLOWER SCHOOLLEKKIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080066AUNTY AYO INTERNATIONAL SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080074BETTE R FOUNDATION EDUCATIONAL ACADEMYLANGBASAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080075BIJAMIC SCHOOLAJAHPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080079BODMAK SOLID BEGINNINGJAKANDE ESTATE LAGOSPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080087BRIGHTER FUTURE NURSERY AND PRIMARY SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080091BROOK STONES BEST BRAIN INTERNATIONAL SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080112CORONA DAY NURSERYIKOYIPRIVATECONVENTIONALECCE ONLY
ETI-OSA24080113CORONA SCHOOLIKOYIPRIVATECONVENTIONALPRIMARY ONLY
ETI-OSA24080114CORONA SCHOOLVICTORIA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080117CRESENT SCHOOLVICTORIA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080128DEBIRUSES SCHOOLSAJAHPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080137DIAMONDS PRIVATE SCHOOLDOLPHIN IKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080178GENESIS SCHOOLBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080186GOD SAVE NURSERY AND PRIMARY SCHOOLVICTORIA ISLANDPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080203GRACEFIELD NURSERY AND PRIMARY SCHOOLAJIRANPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080204GRAJES NURSERY AND PRIMARY SCHOOLLANGBASAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080211GREENFIELD NURSERY AND PRIMARY SCHOOLETI OSAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080212GREENWOOD HOUSE SCHOOLPARKVIEW ESTATEPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080223HOME SCIENCE ASSOCIATION PRIMARY SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080230IMPERIAL SPRINGS SCHOOLLEKKI PHASE 1PRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080231INDEPENDENT SUCCESS INTERNATIONAL SCHOOLLEKKIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080232INITORO PROGRESS NURSERY AND PRIMARY SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080248JOEF DYNAMIC NURSERY AND PRIMARY SCHOOLIKOYI OBALANDEPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080252KEHSAM NURSERY AND PRIMARY SCHOOLAJIRANPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080277LINSY NURSERY AND PRIMARY SCHOOLIGBO EFONPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080282LORD'S GATE SCHOOLLANGBASAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080287MARIA BREED MONTESSORI NURSERY AND PRIMARY SCHOOLLANGBASAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080315NIGERIAN GIRL GUIDES DAY CARE CENTREIKOYI - OBALANDEPRIVATECONVENTIONALECCE ONLY
ETI-OSA24080324ONWARD PREPARATORY NURSERY AND PRIMARY SCHOOLIJEH IKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080328OYOYO NURSERY AND PRIMARY SCHOOLIJEH IKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080334PINE FIELD SCHOOLLEKKIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080343CURIA REGISVICTORIA ISLANDPRIVATECONVENTIONALECCE ONLY
ETI-OSA24080357RUBYGOLD SCHOOLJAKANDEPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080381ST JOSEPH NURSERY AND PRIMARY SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080385STARBRIGHT PRIVATE SCHOOLAGUNGI/AJIRANPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080433TWINS EDUCATIONAL TUTORS NURSERY AND PRIMARY SCHOOLAJIRANPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080444VICTORIA AIYEYEMI INTERNATIONAL SCHOOLLEKKI JAKANDEPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080455WISDOM HALL INTERNATIONAL SCHOOLBADOREPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080457WOODENTOTS NURSERY AND PRIMARY SCHOOLIKOYIPRIVATECONVENTIONALECCE ONLY
ETI-OSA24080478HOME ECONOMICS AND ARTS/CRAFT CENTRE KEFFIIKOYIPUBLICCONVENTIONALPRIMARY ONLY
ETI-OSA24080479COMPUTER CENTRE KEFFIIKOYIPUBLICCONVENTIONALECCE AND PRIMARY
ETI-OSA24080482VICTORIA ISLAND COMPUTER CENREVICTORIA ISLANDPUBLICCONVENTIONALPRIMARY ONLY
ETI-OSA24080483KURAMO COMPUTER CENTREVICTORIA ISLANDPUBLICCONVENTIONALPRIMARY ONLY
ETI-OSA24080484MINI RESOURCES CENTREVICTORIA ISLANDPUBLICCONVENTIONALPRIMARY ONLY
ETI-OSA24080489ROYAL BREED INTERNATIONAL SCHOOLAJAHPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080491LATTICE VILLE NURSERY/PRIMARY SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080492MYRTLE HOUSE MONTESSORI SCHOOLIKOYIPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080499THE LAGOON SCHOOLLEKKI PHASE 1PRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080518AL-HAKEEM NURSERY AND PRIMARY SCHOOLOKE IRA KEKEREPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080519DUVAL-SCHOOLSADDO, AJAHPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080542CONVENANT HIGH SCHOOL (NURSERY & PRY)ETI OSAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080549SUPREME DOMINION FAMOUS COMPREHENSIVE SCHOOL (NUR/PRY)GBARAPRIVATECONVENTIONALECCE AND PRIMARY
ETI-OSA24080555LEKKI MUSLIM NURSERY AND PRIMARY SCHOOLLEKKI PHASE 1PRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090001ANSAR-UD-DEEN PRIMARY SCHOOL, OLOKOAPARAGI OLOKOPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090002ANWAR-UL-ISLAM PRIMARY SCHOOL, IBEJU-LEKKIEMUPUBLICCONVENTIONALPRIMARY ONLY
IBEJU-LEKKI24090003COMMUNITY PRIMARY SCHOOL, OKEGUN OLOFINOKEGUN, ODOFINPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090004COMMUNITY PRIMARY SCHOOL, ABEGEDEABEGEDEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090005COMMUNITY PRIMARY SCHOOL, ABIJOABIJOPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090006COMMUNITY PRIMARY SCHOOL, AJEGBENWAAJEGBENWAPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090007COMMUNITY PRIMARY SCHOOL, EPUTUEPUTUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090008COMMUNITY PRIMARY SCHOOL, FOLUFOLUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090009COMMUNITY PRIMARY SCHOOL, IBA-OLOJAIBA-OLOJAPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090012COMMUNITY PRIMARY SCHOOL, IGBODOLAIGBODOLAPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
IBEJU-LEKKI24090013COMMUNITY PRIMARY SCHOOL, OGOGOROOGOGOROPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090014COMMUNITY PRIMARY SCHOOL, OTOLUOTOLUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090015COMMUNITY PRIMARY SCHOOL, LAKOWELAKOWEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090016FAZIL OMAR AHMADIYA PRIMARY SCHOOL, IDADOIDADO TOWNPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090017LOCAL GOVERNMENT PRIMARY SCHOOL, AKODOAKODOPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090018LOCAL GOVERNMENT PRIMARY SCHOOL, IDEIDEPUBLICNOMADICECCE AND PRIMARY
IBEJU-LEKKI24090019LOCAL GOVERNMENT PRIMARY SCHOOL, ILEGEILEGEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090020LOCAL GOVERNMENT PRIMARY SCHOOL, OKUN-MOPOOKUN-MOPU, IJEBU.PUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090021LOCAL GOVERNMENT PRIMARY SCHOOL, OKUN-SOLUOKUN-SOLU ALADEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090022LOCAL GOVERNMENT PRIMARY SCHOOL, ORIYANRINORIYANRINPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090023R.C.M PRIMARY SCHOOL, AYETEJUAYETEJUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090024R.C.M PRIMARY SCHOOL, BOGIJEBOGIJEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090025R.C.M PRIMARY SCHOOL, IDATAIDATAPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
IBEJU-LEKKI24090026R.C.M PRIMARY SCHOOL, IWEREKUNIWEREKUNPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090027R.C.M PRIMARY SCHOOL, LEPIALEPIAPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090028R.C.M PRIMARY SCHOOL, OKEGUNOKEGUN, BAALEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090029R.C.M PRIMARY SCHOOL, OKUNRAYEOKUNRAYEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090030R.C.M PRIMARY SCHOOL, OLOMOWEWEOLOMOWEWEPUBLICMIGRANT FISHERMEN/ FARMERSECCE AND PRIMARY
IBEJU-LEKKI24090031R.C.M PRIMARY SCHOOL, ORIMEDUORIMEDUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090032ROMAN CATHOLIC MISSION CENTRAL PRIMARY SCHOOL, LEKKILEKKIPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090033ROMAN CATHOLIC MISSION PRIMARY SCHOOL, IBEJUIBEJUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090034ST. DAVIDS ANGLICAN PRIMARY SCHOOL, IBEJU-LEKKIOSOROKOPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090035ST. MARKS R.C.M PRIMARY SCHOOL, AWOYAYAAWOYAYAPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090036ST. PETER'S ANGLICAN PRIMARY SCHOOL, IBEJUMAGBON ALADEPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090037ST. VINCENT'S R.C.M PRIMARY SCHOOL, IDOTUNIDOTUNPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090038TSANGAYA PRIMARYSCHOOL, OROFUN0ROFUN TOWNPUBLICTSANGAYA/ALMAJIRIECCE AND PRIMARY
IBEJU-LEKKI24090039U.P.E. PRIMARY SCHOOL, IBEJU-LEKKISIRIWONPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090041A - SQUARE INTERNATIONA SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090049ALADE COMMUNITY NURSERY AND PRIMARY SCHOOLMAGBON-ALADEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090050ALBESTA ACADEMYLUKERA ELEKOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090051ALLAH UL BAAQI NURSERY AND PRIMARY SCHOOLIKEGONPRIVATEISLAMIYYAECCE AND PRIMARY
IBEJU-LEKKI24090065AUNTY MONNY'S CHILDREN SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090070BENELLA INTERNATIONAL SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090077GOSHEN BEZALEL SCHOOLSAWOYAYPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090091CHARIS CHILDREN ACADEMYFOLUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090096CHOSEM KIDS SCHOOLIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090101CONCEPTUAL SCHOOLSIGANDO OLOJAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090103CONFIRMED GLORY KIDDIES SCHOOLAMETEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090104CORNER STONE KIDDIES COLLEGEIDATAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090107D D T NUSERY AND PRIMARY SCHOOLADEBAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090114DE DOMINION ACADEMYBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090127DIVINE GRACE NURSERY & PRIMARY SCHOOLIKEGUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090129DIVINE SCHOLARS MONTESSORI SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090130DIVINE STARS NURSERY & PRIMARY SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090134DJV FOUNDATION SCHOOLIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090139ECWA ACADEMYBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090142EDIGOLD NURSERY & PRIMARY SCHOOLADEBA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090144ELLA - HART NURSERY/PRIMARY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090156FAITH AND PRAISE ACADEMYFOLUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090160FEL - EBEN NURSERY AND PRIMARY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090169FOLA TENDER CARE NURSERY/PRIMARY SCHOOLOROFUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090185GLONARY SPRINGS NURSERY AND PRIMARY SCHOOLADEBAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090190GOD - IS - KING NURSERY /PRIMARY SCHOOLIBEREKODOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090199GOLDEN STARS ACADEMY NURSERY & PRIMARYIBEJU AGBEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090201GRACE HALL SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090209GREAT TOPEB ACADEMY NURSERY & PRIMARY SCHOOLIBEJU-AGBEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090220FACADEB NURSERY AND PRIMARY SCHOOLAKODOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090221HOLAS NURSERY AND PRIMARY SCHOOL0KUN-ILADOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090222INK & PEN INTERNATIONAL SCHOOLALAKUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090232JESDAN SCHOOLALAKUN BABA-ADISAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090237JOAK NURSERY/PRIMARY SCHOOLOKUN-ILADOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090239JONA - JOSH NURSERY/PRIMARY SCHOOLIBEJU LEKKIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090251KENFAT NURSERY/PRIMARY SCHOOLOWODE LABORAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090252LABORC UNIQUE CHILDREN'S SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090254LAMPSTAND NURSERY/PRIMARY SCHOOLIBEREKOD0PRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090272LOVE SPRING NURSERY AND PRIMARY SCHOOLIBEJU TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090274MACDONALD TREVAN SCHOLADEBAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090277MARK WINNER INTERNATIONAL SCHOOLIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090282MASQFA ISLAMIC DAY SCHOOL ORIMEDUORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090289MERCYFOUNT NURSERY AND PRIMARY SCHOOLITOKEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090293MOASZ NUIRSERY AND PRIMARY SCHOOLIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090297MOUNTAIN OLIVE NURSERY AND PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090299MUHAMMED GHALI INTERNQATIONAL SCHOOLARAROMI EXTENSIONPRIVATEISLAMIYYAECCE AND PRIMARY
IBEJU-LEKKI24090300MURGAF NURSERY AND PRIMARY SCHOOLLEKKIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090311OCEANIA HEIGHTS SCHOOLORIMEDUPRIVATECONVENTIONALPRIMARY ONLY
IBEJU-LEKKI24090312OJESH SCHOOLSIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090314OLUSOLA INTERNATIONAL NURSERY/PRIMARY SCHOOLAKODO OROFUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090317OVERCOMER GROUP OF SCHOOLSBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090326PEEERSMATE MUSLIM CHILDREN ACADEMYORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090329PERCUILAR KIDDIES NURSERY AND PRIMARY SCHOOLIDOTUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090337PRECIOUS ROCK NURSERY & PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090339PREMEG PRIVATE SCHOOLLEKKIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090342PREVIC KIDDIES VARSITYIBEJU, AGBEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090342PRUDENTIAL HEIGHT NURSERY & PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090343PUPPLS IRIS SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090344RACO CHILD NURSERY AND PRIMARY SCHOOLARAROMIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090348RAPID SUCCESS NURSARY/PRIMAR SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090352REDEEMER NURSERY AND PRIMARY SCHOOLMAGBON-ALADEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090367ROYAL FOUNDATION INTERNATIONAL SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090376SANSEC SPRING SCHOOLAKODOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090379SEASIDE NURSERY/PRIMARY SCHOOLOTOLUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090381AMSNAG SCHOOLS (SERIES SCHOOLS)AWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090388ST PETER PRIVATE SCHOOLMAGBON-ALADEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090391STRAIGHT ROUTE NURSERY & PRIMARY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090393SUCCESS FOUNDATION NURSERY & PRIMARYORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090394SUCCESS FRUITS ACADEMYITAMARUNPRIVATECONVENTIONALPRIMARY ONLY
IBEJU-LEKKI24090396SUCCESS NURSERY AND PRIMARY SCHOOLOROFUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090398SUCESSFIELD NURSERY & PRIMARY SCHOOLIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090400SUN GLEE FORMATION SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090408THE BRIGHT PROMISE NUR/PRY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090412THE JONAIS PLACEAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090414THE LORD'S SEEDS CHILDREN SCHOOLIKEBUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090419TITOSAM NURSERY AND PRIMARY SCHOOLAWAYAYE AND BOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090420TITOSAM NURSERY/PRIMARY SCHOOLAW0YAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090426ADBUK INTERNATIONAL SCHOOLIGANDO OLOJAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090428TRIPPLE ''P'' HERITAGE SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090429TRUE HOPE SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090432VALLETTA MONTESSORI SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090433VICTORIA INTERNATIONAL ACEDEMYORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090438VICTORY CHRISTIAN ACADEMYADEBAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090455IBEJU COMPUTER CENTRE, IBEJUIBEJUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090456MINI RESOURCE CENTER, IBEJUIBEJUPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090457COMPUTER CENTER LEKKILEKKIPUBLICCONVENTIONALPRIMARY ONLY
IBEJU-LEKKI24090458HOME ECONOMIC CENTER, IJEBU/LEKKI,LEKKILEKKIPUBLICCONVENTIONALPRIMARY ONLY
IBEJU-LEKKI24090461INIOLUWA NURSEY AND PRIMARY SCHOOLEBUTEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090462AL-ISTIQOMAH MODEL SCHOOL ELEPETE COMMUNITYBABA ADISAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090463DIVINE GRACE BAPTIST CHILDREN NURSERY AND PRIMARY SCHOOLOTOLUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090464COVENANT CHILDREN COLLEGEIMAGBON-ALADEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090465REAL LIGHT SCHOOLSELEPETE-AYETEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090466SUCCESS SPRING INTERNATIONAL SCHOOLAYETEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090467WONDERFUL KIDDIES NURSERY AND PRIMARY SCHOOLONOSAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090468WISDOM FOUNDATION NURSERY AND PRIMARY SCHOOLONOSAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090469DAMASON NURSEY AND PRIMARY SCHOOLONOSAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090470JOYPRES NURSERY AND PRIMARY SCHOOLONOSAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090471COMMUNITY PRIMARY SCHOOL ADEBAADEBAPUBLICCONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090472DIVINE NURSERY AND PRIMARY SCHOOLOROFUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090473THE FOUNTAIN ACADEMY OROFUN-AKODOOROFUN-AKODOPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090474GOD'S GLORY INTERNATIONAL PRIVATE SCHOOL,OROFUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090475MONSHOLLY NURSERY AND PRIMARY SCHOOLOROFUN TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090476TOLIP NJURSERY AND PRIMARY SCHOOLOROFUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090477TEHILLAH INTERNATIONAL SCHOOL(PRIMARY)IGANDO OLOJAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090479GOD'S GIFT MONTESSORI SCHOOLONO-OSAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090481COOLWAY INTERNATIONAL SCHOOL (PRIMARY)IGANDO OLOJAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090482SAMBEST GLORIOUS INTERNATIONALONO OSA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090483DOTMOND NURSERY AND PRIMARY SCHOOLONA OSA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090484DELAKS HEIGHT SCHOOLONO OSAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090485AS- SALAM ISLAMIC FOUNDATION SCHOOLONO OSA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090486LEKKI FOUTAIN SCHOOLIGANDO OLOJAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090487GLORIOUS LIBERTY INTERNATIONAL SCHOOLLAKOWEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090488KING HEPHZIBAH ROYAL SCHOOLADEBA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090490ROMATH SCHOOLSADEBAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090493MASTERPIECE SCHOOLIBEJU, LEKKIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090494ROCKSON GATES SCHOOL INTERNATIONALIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090495WHOLESOME HERITAGE SCHOOLAYEGBAMI, IBEJURPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090498GODWINS ROYAL ACADEMYOKEGUN ODOFINPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090499LOTI EREWA SCHOOLSIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090500MISHMISH INTERNATIONAL SCHOOLIBEJU, AYEGBAMIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090501CALIDA INTERNATIONAL SCHOOLKAIYETOROPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090502THE BEST ASSURANCEIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090503LEKKI CHILDREN SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090504STREAM OF GRACE SCHOOLSIBEJUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090507HEDASHA DAYLIGHT SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090508WAY MAKER ACADEMYBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090510ROYAL N. DESTINY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090511NEW CREATION BAPTIST NURSERY AND PRIMARYBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090512EMPERORS FIELD NURSERY AND RIMARY SCHOOLALAKUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090512HONEYCHILD NURSERY AND PRIMARY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090513LICIAN DISCOVERY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090513WUNMI NURSERY AND PRIMARY SCHOOLALAKUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090514SUCCESS POWER SCHOOL AND COLLEGEBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090515CONVENANT CHILD PRIMARY SCHOOLALAKUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090515ZION KIDS ACADEMYBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090516CEDAR GROWS NURSERY AND PRIMARY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090516GOLDEN BEACH ACADEMYORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090517ATLANTIC SUCCESS NURSERY AND PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090517FIRST STEP HERITAGE SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090518BEST WINNERS SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090518FAD-L-OMAR ISLAMIC NURSERY AND PRIMARY SCHOOLMAGBON-ALADEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090519LAND OF GLORY ACADEMYALAKUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090519MAREJ MODERN NURSERY AND PRIMARY SCHOOLBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090520DOD'S ADEM SCHOOLSBOGIJEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090520FREEDOM STAR NURSERY AND PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090522MONFEH MONTESSORI PRIVATE SCHOOLMAGBO-ADELEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090523CROWN OF GLORY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090524ONWARD NURSERY AND PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090525REMAJET NATION SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090527TREASURE ISLAND NURSERY AND PRIMARY SCHOOLDESAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090528DISTINCTIVE CHAMPIONS SCHOOLIGBOJIAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090529DIAMOND MINES SCHOOLSIGBOJIAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090530ICON FOUNDATION SCHOOLSIGBOJIAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090531SHINING LIGHT MODEL SCHOOLSHAPATIPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090531THE BLEST SCHOOLADEBA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090532BRIDGESTONE SCHOOLADEBA TOWNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090533OLADEX NURSERY AND PRIMARY SCHOOLMAGBON-ALADEPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090533WILLIAM THORPE NURSERY AND PRIMARY SCHOOLADEBA TOUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090536KING OF KINGS NURSERY AND PRIMARY SCHOOLORIMEDUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090536MANOS HOUSE SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090537PURPOSEFUL CHILD SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090538JEEVIC SUPERB SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090538SILVER AND GOLD NURSERY AND PRIMARY SCHOOLITAMARUNPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090539ARK INTERNATIONAL SCHOOLAPAKINPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090539GENREV SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090540JUBILANT FOUNDATION SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090541AUNTY KENNY BRILLIANT SCHOOLAPAKINPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090543GOD'S FAVOUR STANDARD SCHOOLABULE PARAPO ,AWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090544PURPOSEFUL VISION NURSERY AND PRIMARY SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090545FULFILL CHILD NURSERY AND PRIMARY SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090546GOD'S CITADEL INTERNATIONAL SCHOOLSAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090548OLADOYIN NURSERY AND PRIMARY SCHOOL AWOYAYAAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090551JO BRIGTH KIDS ACADEMYOGUNFAYO EPUTUPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090552CHILD OF DESTINY SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IBEJU-LEKKI24090553SEEKERS NURSERY AND PRIMARY SCHOOLAWOYAYAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100001AFRICAN CHURCH PRIMARY SCHOOL, IFAKO-IJAYEIFAKO IJIAYEPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100002AGBADO IJAYE PRIMARY SCHOOL I, ALAKASHE, OJOKOROIJAIYE OJOKOROPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100003AGBADO-IJAIYE PRIMARY SCHOOL, IFAKO-IJAYEIJAIYE OJOKOROPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100004ALL SAINTS PRIMARY SCHOOL, IJU-GAREJETOWNPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100005AYANLEYE MEMORIAL PRIMARY SCHOOL, AFAKO-IJAYEIFAKO IJIAYEPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100006BISHOP OLUWOLE PRIMARY SCHOOL, AFAKO-IJAYETOWNPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100007COKER MEM. PRIMARY SCHOOL, AFAKO-IJAYEIFAKO IJAIYEPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100008EBENEZER AFRICAN CHURCH PRIMARY SCHOOL II, AFAKO-IJAYEOJOKOROPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100009EBENEZER AFRICAN PRIMARY SCHOOL, AFAKO-IJAYEOJOKOROPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100010FIRST AFRICAN CHURCH MISSION PRIMARY SCHOOL ONEITU ISHAGAPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100011FIRST AFRICAN CHURCH MISSION NUR & PRIMARY SCHOOL, TWO IJU-ISHAGATOWNPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100012FRED WILLIAMS MEMORIAL PRIMARY SCHOOL, IJU RAILWAY STATIONIJUPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100013GBELEYI PRIMARY SCHOOL, I ALAKUKOAMJE ALAKUKOPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100014GBELEYI PRIMARY SCHOOL II, AFAKO -IJAEYIALAKUKOPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100015HOLY TRINITY PRIMARY SCHOOL, EGBETEDOTOWNPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100016IJU STATION PRIMARY SCHOOL II, IJUIJUPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100017IJU STATION PRIMARY SCHOOL I, IJU STATIONIJU RAILWAY STATIONPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100018KARAOLE PRIMARY SCHOOL, AFAKO -IJAEYIIFAKO IJAIYEPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100019NEW OKO-OBA PRIMARY SCHOOL, NEW OKO-OBAABULE EGBAPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100020OGUNDIMU PRIMARY SCHOOL, IJUTAWNPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100021SAVIOUR'S PRIMARY SCHOOOL, AFAKO-AJAEYIORILE AGBADO LAGOSPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100022ST. KIZITO'S CATHOLIC NUR & PRIMARY SCHOOL, AFAKO-AJAEYIIJU ISHAGAPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100023ST. KIZITOS CATHOLIC PRIMARY SCHOOL 11, IFAKO -AJAEYIIJU STATIONPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100023ST. KIZITOS CATHOLIC PRIMARY SCHOOL, AFAKO -AJAEYITOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100024VETLAND PRIMARY SCHOOL, OKO-OBAVETLAND PRIMARY SCHOOL,OKO -OBAPUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100025WESLEY PRIMARY SCHOOL, OKO-OBAWESLEY PRIMARY SCHOOL,OKO-OBA.PUBLICCONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100027AB&M PREPARATORY PRIMARY SCHOOLOJKOROPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100031ABOVE GLORY PRIVATE SCHOOLTOWNPRIVATECONVENTIONALPRIMARY ONLY
IFAKO-IJAIYE24100043ADEOLA GROUP OF SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100052AGAPE B NURSRY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALPRIMARY ONLY
IFAKO-IJAIYE24100062AL--FAWZ INTERNATIONAL NUR/PRY SCHOOLIFAKOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100063KARMELPREPAPATORY SCHOOLOBAWOLEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100075AMBI DAYBY DAY NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100079ANASTANSHIA INTERNATIONAL NUR/PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100081ANTIOCH INTERNATIONAL SCHOOLIJAIYEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100082ANWARU ISLAM GIRLS HIGH SCHOOLOJOKOROPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100083APATA NURSERY AND PRIMARY SCHOOLAPATA NUSERY AND PRIMARYPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100089WISDOM LANE NURSERY & PRIMARY SCHOOLAGEGEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100092AT-TAWAWAKKUL MONTESSORI SCHOOLSTOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100093AUNTY WINNER PRIVATE SCHOOLALAKUKOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100102BACHEL MONTESSORI SCHOOLIFAKO IJAIYEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100105BARACHEL NURSERY AND PRIMARY SCHOOLIJU ISHAGAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100107BARACHEL NURSERY AND PRIMARY SCHOOLIFAKOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100112BAYNES MONTESSIRI SCHOOLBAYNES MONTESSORI SCHOOL.PRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100121BENGLAMIR PRIVATE SCHOOLIJU ISHAGAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100122BENLAD UNITY SCHOOLIJU ISHAGAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100125BERIT SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100128BEST MOULD MUSLIM SCHOOLAMJE ALAKUKOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100134BETHESDA MONTESSORI SCHOOLOGBAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100139BEULAH INTERNATIONAL SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100140BINTOS INTERNATIONAL NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100145BIZBEN INTERNATION SCHOOLOBAWOLE IYUPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100148BLESSED HOME NURSERY AND PRIMARY SCHOOLABULE EGBAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100149BLESSED TWINS PRIVATE SCHOOLALAKUKOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100150BLESSED NURSERY AND PRIMARY SCHOOLAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100153BLISSVILLE NURSERY AND PRIMARY SCHOOL.OKE RAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100154BLOSSOMAILL SCHOOLSIFAKO IJAIYEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100155BLUE SKY SCHOOLS SECONDARY SCHOOLTOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100162BONNY INTERNATIONAL NUR/PRY SCHOOLBONNY INTERNATIONAL NUR/PRY SCHOOLPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100163BOTSUN PRIVATE SCHOOLAJEGUNLE ALKUKOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100165BRAIN BUILDER NURSERY AND PRIMARY SCHOOLALAGBADOPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100169BRIDGES SCHOOLSIJU ISHAGAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100172BRIGHT BEGINNING SCHOOLSIJAIYEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100176BRIGHTER FUTURE BASIC SCHOOLBRIGTHTER FUTURE BASIC SCHOOLPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100180C & J FAST TRACK NURSERY AND PRIMARY SCHOOLOBAWOLEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100182CALVARY COMPREHENSIVE COLLEGETOWNPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100190CATCH THEM YOUNG NUR/PRY SCHOOLOJOKOROPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100191CDC NURSERY AND PRIMARY SCHOOLTOWNPRIVATECONVENTIONALPRIMARY ONLY
IFAKO-IJAIYE24100199CHAMPION CHILDREN SCHOOLCHAMPION CHILDREN SCHOOLPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100201CHESSVILLE PRIVATE SCHOOLSIJU ISHAGAPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100204CHILD WORLD MISSION SCHOOLIJAIYEPRIVATECONVENTIONALECCE AND PRIMARY
IFAKO-IJAIYE24100218CLASAM NUR/PRIMARY SCHOOLAHMADIYAPRIVATECONVENTIONAL